Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00012380001
Length(AA) : 171
Localization : scaffold_152
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: phosphatidylglycerol / phosphatidylinositol transfer protein
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001558322.1| Score: 348 E_value: 1e-31
KEGG Definition: uncharacterized conserved protein, contains ML domain
Accession: aor:AO090026000516 Score: 343 E_value: 3e-31
KOG Definition: Uncharacterized conserved protein
Classification: [
Kog Number: KOG4680 Score: 254 E_value: 4e-23
PFAM Definition: E1_DerP2_DerF2, ML domain. ML domain - MD-2-related lipid recognition domain. This family consists of proteins from plants, animals and fungi, including dust mite allergen Der P 2. It has been implicate in lipid recognition, particularly in the recognition of pathogen related products. A mutation in Npc2 causes a rare form of Niemann-Pick type C2 disease..
Pfam Number: pfam02221 Score: 129 E_value: 1e-08
Swissprot: O94183|NPC2_ASPOR

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.916YES0.988YES0.898YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0310.9350.109S118

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.2911First60=1.28911PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00012380001
MKLSIIYLILLITGSTSAESLFHKLAKHLTPPTTGLKEIPGENPLKHCFE
DHSRDIFTLEKVNLTPNPPIRGKPLTIQVVGMLKDRVSQGAHVDVTVKYG
LITLMKQSLHICDHVDELGLECPIGQGKLTLTKVIDIPKLIPPGKYTLKC
NVAIAGDKPMTCLTGTIAFSG

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB41YJ04FM1 hypothetical protein FG09586.1 [Gibberella zeae PH-1]2e-25


Manual Annotation:

Please find below the necessary files for GSTUMT00012380001 annotation :

link to GSTUMT00012380001 Artemis file
link to scaffold_152 sequence file
link to scaffold_152ESTs