Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00012210001
Length(AA) : 395
Localization : scaffold_98
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001541134.1| Score: 925 E_value: 8e-98
KEGG Definition: hypothetical protein
Accession: mgr:MGG_02799 Score: 903 E_value: 1e-95
KOG Definition: Nucleotide excision repair factor NEF2
Classification: [
Kog Number: KOG1929 Score: 109 E_value: 8e-06
PFAM Definition: BRCT, BRCA1 C Terminus (BRCT) domain. The BRCT domain is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage. It has been suggested that the Retinoblastoma protein contains a divergent BRCT domain, this has not been included in this family. The BRCT domain of XRCC1 forms a homodimer in the crystal structure. This suggests that pairs of BRCT domains associate as homo- or heterodimers..
Pfam Number: pfam00533 Score: 131 E_value: 2e-08
Swissprot: Q12114|CHS5_YEAST
Gene Ontology:
GO:0034044 = Cellular component: exomer complex
GO:0032588 = Cellular component: trans-Golgi network membrane
GO:0006039 = Biological process: cell wall chitin catabolic process
GO:0000282 = Biological process: cellular bud site selection
GO:0000747 = Biological process: conjugation with cellular fusion
GO:0030476 = Biological process: ascospore wall assembly
GO:0006893 = Biological process: Golgi to plasma membrane transport

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.408NO0.766NO0.287NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0410.4810.688_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00574First60=0.00574PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00012210001
MLVSLTVGKVDAGLAILLTEEKRLIEFPSVLLPPGIVSGSIVDIQISQNT
EAEDAARKAFNALQEEIYNLYGIHSPSKPVLRVRNATQTSVVLEWDPVQL
ATATLRSLTLYRNNSKAGAIPNPTTHTSTKISGLALDTEYSFHLILRTSA
GTYSSEKLTVRTHKMTDLSGITVCPGVMPGETREELEVALQRIGAKPLQD
FVRIDTTHFVCTEGRGQNWERAQEMNIPVVRPEWLHACEKEGRIVGVRQF
YLGADVSRMRQGLQQQGSRPQQHRPTQSMTESPATTPVATSVAERRDSRH
EIPTIERRETRQESPTPITKHEEEGEKDPREDEDRRGGAKEDQEEKTPLS
EHSAEGEAFDIVTLDNGRSAPTALGPETPVTDTGKTEEGFEEVRL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1697 chitin biosynthesis protein (Chs5) [Aspergillus fumigatus Af293]1e-66
Contig2835 hypothetical protein BC1G_15060 [Botryotinia fuckeliana B05.10]7e-16


Manual Annotation:

Please find below the necessary files for GSTUMT00012210001 annotation :

link to GSTUMT00012210001 Artemis file
link to scaffold_98 sequence file
link to scaffold_98ESTs