Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00012188001
Length(AA) : 550
Localization : scaffold_98
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_07290
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001797631.1| Score: 885 E_value: 6e-93
KEGG Definition: hypothetical protein
Accession: ncr:NCU04855.1 Score: 849 E_value: 4e-89
KOG Definition: Activating signal cointegrator 1
Classification: [Transcription].
Kog Number: KOG2845 Score: 278 E_value: 3e-25
PFAM Definition: zf-C2HC5, Putative zinc finger motif, C2HC5-type. This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4..
Pfam Number: pfam06221 Score: 169 E_value: 1e-12
Swissprot: O13855|YEX1_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.181NO0.417NO0.140NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.10.1440.767_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00012188001
MSSKSSTESWALTRLESLLPLPEDSLRDVITYALSLTDPSGVSSHFEGLL
GSTEEVLDFISDFNSRLFPQRATRESTTLQSSSSTSSLNAPPAKRRGKKG
KLPINRYANRPRQVEGQFGNPAAVYMKKDVEDEYYTGGSKGPTSKPVDSP
SPSSSVPVSRTATPAPRSASPQRAQQKAQQSSNSNIGGKLVSDLLNVKTK
VKKAPQKVHVTGGVAMRGASAELTDLESALRALELSTNPTLTSKSQKCNC
AGMKHEVLSAAPNCLSCGKIICIKEGLAPCSFCNTPLIPPEELQSMVREL
REESGRERMAINNATQKRPEVVHAPKPFSSYDSTPKTNDEGLKKATEHRD
RLLGFQATSAQRTKIIDQAADFETPAMGSSMWATPQERALQLKKQQKAMR
EMEWRAKEDYEKRQVVVAIDLKGRQAVRKMQEIERPREDSDDGDIEEAYD
DTLERGGTAAATDSSTSKGGAYSRNPLLKGMIKPVYDSGKGKGKGKQGDE
IVDARPGAYAGGSRGWRRVQDDFADNEGVTLDGGVGREERGTQGEEPACG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3788 No hit found
SY0AAC47YG03FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00012188001 annotation :

link to GSTUMT00012188001 Artemis file
link to scaffold_98 sequence file
link to scaffold_98ESTs