Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00012114001
Length(AA) : 579
Localization : scaffold_96
Number of EST contigs matching the gene: 12
Number of ESTs : 744
  User annotation : No user annotation

Blast Results:

Nr Definition: heat shock protein sspB-Aspergillus niger emb|CAK40452.1| heat shock protein sspB-Aspergillus niger
Specie: [
Accession: ref|XP_001393974.1| Score: 1699 E_value: 0.0
KEGG Definition: sspB; heat shock protein sspB-Aspergillus niger
Accession: ang:An09g06590 Score: 1699 E_value: 0.0
KOG Definition: Molecular chaperone (HSP90 family)
Classification: [Posttranslational modification
Kog Number: KOG0019 Score: 1755 E_value: 0.0
PFAM Definition: HSP90, Hsp90 protein..
Pfam Number: pfam00183 Score: 2128 E_value: 0.0
Swissprot: O43109|HSP90_PODAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.138NO0.324NO0.116NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0610.1340.862_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.3868First60=0.38109PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00012114001
MEALSAGADISMIGQFGVGFYSAYLVADKVEVVTKSNEDEQYIWESAAGG
SFTIKLDETGERIKRGTKIVLHIKDGLQEYLEESKIKEIVKKHSEFISYP
IFLHVTKEVEREVPDEDEEEEKTEEGDDKKPKIEEVDEEEEKKEKKTKKV
KETKEEEEELNKTKPIWTRNPSDITTEEYASFYKSLSNDWEDHLAVKHFS
VEGQLEFRAILFVPKRAPFDLFETKRSKNNIKLYVRRVFITDDCTDLIPE
WLGFIKGVILKVIKKNIVKKTLEMFNEISEDREQFDKFYSAFSKNIKLGI
HEDAQNRPALAKLLRFNSTKSGDDATSLTDYVTRMPEHQKQMYYITGESL
KAVSKSPFLDALKAKDFEVLFLVDPIDEYAMTQLKEFDGKKLVDITKDFE
LEETEDEKKQREEEEKAFEGLAKTLKEVLGEKVEKVVVSHKLVDAPAAIR
TGQFGWSANMERIMKSQALRDTSMSSYMASKKTFEISPKSPIIKALKEKA
EEEGGSKAVASIATLLYETAMLTSGFTLEEPNAFAQRVNRLIALGLQIEE
KDDEEEPEAEAAPAAESSAAPESSMEEVD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig935 unnamed protein product [Aspergillus oryzae]2e-69
Contig1060 heat shock protein 82 [Aspergillus terreus NIH2624]8e-84
Contig2119 heat shock protein sspB-Aspergillus niger emb|CAK40452.1| heat shock protein sspB-Aspergillus niger0.0
Contig2556 heat shock protein 82 [Aspergillus terreus NIH2624]3e-76
SY0AAA30YA19FM1 hypothetical protein BC1G_07315 [Botryotinia fuckeliana B05.10]3e-25
SY0AAA35YM24FM1 heat shock protein sspB-Aspergillus niger emb|CAK40452.1| heat shock protein sspB-Aspergillus niger5e-42
SY0AAA4YA19FM1 ATP-dependent molecular chaperone HSC82 [Ajellomyces capsulatus NAm1]2e-79
SY0AAB15YB24FM1 heat shock protein sspB-Aspergillus niger emb|CAK40452.1| heat shock protein sspB-Aspergillus niger2e-34
SY0AAB38YI02FM1 ATP-dependent molecular chaperone HSC82 [Ajellomyces capsulatus NAm1]1e-54
SY0AAB3YG05FM1 Heat shock protein 90 homolog [Pichia stipitis CBS 6054]6e-55
SY0AAB46YB17FM1 unnamed protein product [Aspergillus oryzae]1e-63
SY0AAD17YE20FM1 unnamed protein product [Aspergillus oryzae]2e-64


Manual Annotation:

Please find below the necessary files for GSTUMT00012114001 annotation :

link to GSTUMT00012114001 Artemis file
link to scaffold_96 sequence file
link to scaffold_96ESTs