Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00012092001
Length(AA) : 776
Localization : scaffold_96
Number of EST contigs matching the gene: 2
Number of ESTs : 13
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_11740
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001549982.1| Score: 726 E_value: 2e-74
KEGG Definition: hypothetical protein
Accession: fgr:FG07231.1 Score: 680 E_value: 2e-69
KOG Definition: Protein phosphatase 1
Classification: [
Kog Number: KOG0531 Score: 181 E_value: 8e-14
PFAM Definition: No Hit Found
Swissprot: Q9UUG2|YFT6_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0005774 = Cellular component: vacuolar membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.054NO0.161NO0.069NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1590.0680.851_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03015First60=0.00689PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00012092001
MDSEDGHTYIKHLAHFVRTHEKALANALQLQRRQPRRSDTAPAVSGRTPA
SLQYVHGSSSTSSTLAAAFSLPSLSFTSQHLKPAKLGLTPHHLYYLLSRF
EELNIPVGPMGVRLENIHAESSPGNYVSFLRDASGRRNHSSDSLSIHSVS
SVRSVMSGMSSLWSSIGLGTSASVKSERAKAALEADLKYLYSAFTKIPCL
RLAPDRKARLIEGFEEFPFDTAVPLLAFKNVSALEICDIDIRQFFGWDQL
AERLRSLVVKRGGIKDPSELIIAIVLDDMDKRRRRSAKSSSSPIISYPSS
SPGLGNEGEPSTPPSPTLGQIGSSSAPAGHYHAMSRVPSNSSRSSSKNRP
RSNSPTRPASSRTNSTATNSHSRSHRMRRSGSGSSHSSSTSTLLPSSHGL
TLPAILPNTKWRFLRHLSLADNGLLSISSAALTPLAGSLSSLDLSNNLFK
SIPECLSILYNLRALNLSGNMIDSLHSLTRNPLPAITALNLRGNVLASIA
GVERLLSLERLDLRENRLTDPTELARLTGVPNIAEIWIASNPFTKTHSCY
RVTIFNLFRETPGYSDDISLDSQKPGMMEKRNLKDRVAENPAVPVMRVPP
SPTVAVNTVSPVDSKKKDRHDNEKIIKIGNGEVARAKKRVGRRRVVELSR
DDSDVSIHQDMQSNTKPTAIRSTSQSRPVVVSSSKLPTAPKEIYHPPEET
SSGAESSPPNHHSSPSENVDWAQKGDEYRRKVEALRSEVGSGWLSVLSEE
GMSLAPSRKVSSPSTPASGPAQQKSD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1752 hypothetical protein BC1G_11739 [Botryotinia fuckeliana B05.10]5e-06
Contig3717 hypothetical protein BC1G_11740 [Botryotinia fuckeliana B05.10]2e-74


Manual Annotation:

Please find below the necessary files for GSTUMT00012092001 annotation :

link to GSTUMT00012092001 Artemis file
link to scaffold_96 sequence file
link to scaffold_96ESTs