Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00012075001
Length(AA) : 613
Localization : scaffold_95
Number of EST contigs matching the gene: 3
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An14g02230
Specie: [Aspergillus niger]
Accession: ref|XP_001400849.1| Score: 1958 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An14g02230 Score: 1958 E_value: 0.0
KOG Definition: Serine/threonine protein kinase
Classification: [Signal transduction mechanisms].
Kog Number: KOG1290 Score: 1493 E_value: 1e-166
PFAM Definition: Pkinase, Protein kinase domain..
Pfam Number: pfam00069 Score: 266 E_value: 8e-24
Swissprot: P36616|DSK1_SCHPO
Gene Ontology:
GO:0000935 = Cellular component: barrier septum
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0005515 = Molecular function: protein binding
GO:0004674 = Molecular function: protein serine/threonine kinase activity
GO:0006468 = Biological process: protein amino acid phosphorylation
GO:0007243 = Biological process: protein kinase cascade
GO:0007346 = Biological process: regulation of mitotic cell cycle
GO:0048024 = Biological process: regulation of nuclear mRNA splicing
via spliceosome

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.024NO0.039NO0.025NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0730.0510.925_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00387First60=0.0012PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00012075001
MNGDVGVKKATMNKMKQVANAATGSGAIANGNKKRRKGQDLKPIITGEQQ
NGSSPPVPATVAGDKQSDVNTQSLLSHQKPTSTVAITTTPPNDTPTSATS
ANSRVSSSSRTGEEDEGNTADEEDYEDYCKGGYHPVTVGEKFKDGRYEVL
RKLGWGHFSTVWLSRDERTGQHVALKVVRSASHYTETALDEIKLLQRIVA
AKPTHPGKAHVVSLLDSFEHKGPNGNHVCMVFEVLGENLLGLIKRYNHRG
IPMGLVKQITKQVLLGLDYLHRECGIIHTDLKPENVLIEIGDVEQITKKN
GSLAPGDKGDRNGRRRRRTLITGSQPLPSPISANFAHRHDDLPSAGGLRN
NHSSLSRLMASATADSNGGSETSFSSGNGRDYLSYKVREKTADVITREVS
GISLDKTGSDSDMVPGLEAISVKIADLGNACWVNHHFTNDIQTRQYRSPE
VILGAKWGASTDIWSMACMVFELITGDYLFDPQSGTKYGKDDDHIAQIIE
LLGSFPRHLCMTGKWSMEIFNRKGELRNIHRLRHWALPDVLREKYHFSRE
DSEQISELLVPMLELNPEKRANAGGMSNHGFIKEAISMENKNVDVVVGSR
GGIEGWACEVKKR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1805 protein kinase dsk1 [Aspergillus terreus NIH2624]2e-28
Contig6152 hypothetical protein An14g02230 [Aspergillus niger]2e-79
SY0AAD5YA16FM1 unnamed protein product [Aspergillus oryzae]1e-80


Manual Annotation:

Please find below the necessary files for GSTUMT00012075001 annotation :

link to GSTUMT00012075001 Artemis file
link to scaffold_95 sequence file
link to scaffold_95ESTs