Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00012037001
Length(AA) : 499
Localization : scaffold_94
Number of EST contigs matching the gene: 2
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: NADH-ubiquinone oxidoreductase 51 kDa subunit
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001549682.1| Score: 2197 E_value: 0.0
KEGG Definition: NUBM_NEUCR NADH-ubiquinone oxidoreductase 51 kDa subunit, mitochondrial precursor (Complex I-51KD) (CI-51KD)
Accession: fgr:FG09250.1 Score: 2142 E_value: 0.0
KOG Definition: NADH:ubiquinone oxidoreductase
Classification: [
Kog Number: KOG2658 Score: 1952 E_value: 0.0
PFAM Definition: Complex1_51K, Respiratory-chain NADH dehydrogenase 51 Kd subunit..
Pfam Number: pfam01512 Score: 1021 E_value: 1e-111
Swissprot: P24917|NDUV1_NEUCR

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.401NO0.700NO0.343NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8890.0280.101M236

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01578First60=0.00861PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00012037001
MFLARNPQCGVIALASSHLARSSAIAVYRQQGSRNLATVSDTPTRSYGGL
KDQDRIFQNLYGHHGTDLKSAMKYGDWYKTKEILLKGHDWIIGEIKTSGL
RGRGGAGFPSGMKWSFMTPPGWNTGTTPRYLVVNADEGEPGTCKDREIMR
KDPHKLVEGCLVAGRAMEATAAYIYIRGEFYHEATVLQRAIQEAYSAGLI
GKNACGSGYDFDVFVHRGMGAYVCGEETSLIESLEGKPGKPRLKPPFPAS
VGLFGCPSTVANVETVSVAPTICRRGGSWFASFGRKRNEGTKLFCISGHV
NNPCTVEEEMSIPLKELIERHCGGVRGGWDNLQAIIPGGSSTPILPRKIC
DDVLMDFDALKDVQSGLGTAAVIVMDKSTDVVRAISRLSKFYKHESCGQC
TPCREGTRWTAQIMERFEKGQGREREIDMLQELTKQVEGHTICALGEAFA
WPLQGLIRHFRPELEARMQAHAQASGGEALAGGWEHNARVQGKLVAPGQ

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1174 hypothetical protein SNOG_06231 [Phaeosphaeria nodorum SN15]2e-79
Contig4848 NUBM_NEUCR NADH-ubiquinone oxidoreductase 51 kDa subunit, mitochondrial precursor (Complex I-51KD) (CI-51KD) [Gibberella zeae PH-1]1e-130


Manual Annotation:

Please find below the necessary files for GSTUMT00012037001 annotation :

link to GSTUMT00012037001 Artemis file
link to scaffold_94 sequence file
link to scaffold_94ESTs