Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00012001001
Length(AA) : 543
Localization : scaffold_93
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : Tmel_mPR_like_2  [+]

Blast Results:

Nr Definition: hypothetical protein BC1G_11854
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001549962.1| Score: 1008 E_value: 1e-107
KEGG Definition: hypothetical protein
Accession: ang:An07g09280 Score: 980 E_value: 1e-104
KOG Definition: Predicted membrane proteins
Classification: [
Kog Number: KOG0748 Score: 626 E_value: 1e-65
PFAM Definition: HlyIII, Haemolysin-III related. Members of this family are integral membrane proteins. This family includes a protein with hemolytic activity from Bacillus cereus. It is not clear if all the members of this family are hemolysins. It has been proposed that YOL002c encodes a Saccharomyces cerevisiae protein that plays a key role in metabolic pathways that regulate lipid and phosphate metabolism..
Pfam Number: pfam03006 Score: 425 E_value: 3e-42
Swissprot: Q09910|YAJB_SCHPO
Gene Ontology:
GO:0005789 = Cellular component: endoplasmic reticulum membrane
GO:0005794 = Cellular component: Golgi apparatus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.025NO0.049NO0.024NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0780.0630.906_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=143.793First60=0.00053PredHel=7
Topology=(309-328,341-363,378-400,407-424,434-456,463-485,500-522)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00012001001
MAAIQGSEIKIKPTKSIGDWAKPNNKTDVQCFMGFCNFYRSGSFQPKPKD
NDRNGYLKIFPRPRFTSALVPTVEPLFAAAGSSTSTATDSWKTFGSPKVT
YRKSRRHSSHHVRSRNFSADFLEDDSILLLKVDLFLSELERRLDYLEEYG
NIKLDEGIQRAYDTLQAVREGCGRVGGEVIGEGKRRARVIVEVLESSYHE
VIEAKETLPAKVHAGVRFLEELLTEFEMCSHASMDRKLGQAMRGVEAVID
AKDKLAESIERAIKAARERRLITYEELPFPWRVNPYITRGYRFTETKLEC
VRSAFALNNETCNIWTHGLGFILILAIAFYFYPMSQIFNNHTTADKFING
LFFLAAAKALACSTIWHTFSSISHQTTMERFACVDYSGISMLIAASIITT
EYTAFYVEPISRSIYITITFLFGVAGVILPWKPAFNRADMRVWRVAFYVT
LGATGTIPMIQLSITRGRSWVALFYLPVLKSIAVYIAGALIYAMQVPERF
YPGCFDWIGGSHNIWHVCVLGGILFHWHAMHDLFHRAFEMATA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3536 hypothetical protein SS1G_04806 [Sclerotinia sclerotiorum 1980]5e-09
SY0AAB16YP01FM1 hypothetical protein CIMG_07991 [Coccidioides immitis RS]6e-15


Manual Annotation:

Please find below the necessary files for GSTUMT00012001001 annotation :

link to GSTUMT00012001001 Artemis file
link to scaffold_93 sequence file
link to scaffold_93ESTs