Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011958001
Length(AA) : 263
Localization : scaffold_93
Number of EST contigs matching the gene: 4
Number of ESTs : 50
  User annotation : No user annotation

Blast Results:

Nr Definition: 14-3-3 protein
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001553570.1| Score: 1064 E_value: 1e-114
KEGG Definition: hypothetical protein
Accession: mgr:MGG_13806 Score: 1038 E_value: 1e-111
KOG Definition: Multifunctional chaperone (14-3-3 family)
Classification: [Posttranslational modification
Kog Number: KOG0841 Score: 911 E_value: 5e-99
PFAM Definition: 14-3-3, 14-3-3 protein..
Pfam Number: pfam00244 Score: 1028 E_value: 1e-112
Swissprot: Q99002|1433_TRIHA

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.019NO0.041NO0.017NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0440.0640.961_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01705First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011958001
MTTEQDFPRQIRYDEMVTYMKEVAKLGGELSVDERNLLSVAYKNVVGTRR
ASWRIISSIEQKEETKGSEKHVTKIREYRQKIETELEQVCGDVLNVLDES
LIPKAESGESKVFYHKMKGDYHRYLAEFASGDKRKDAATAAHEAYKNATD
VAQTELTPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELD
SLSEESYRDSTLIMQLLRDNLTLWTSSESGDAEESAPAKEEAKVTEAKPE
EAPAASAPAEETK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1810 14-3-3 protein [Botryotinia fuckeliana B05.10]3e-45
Contig2813 14-3-3 protein [Botryotinia fuckeliana B05.10]2e-54
Contig3015 14-3-3 protein [Botryotinia fuckeliana B05.10]1e-124
SY0AAB25YD15FM1 14-3-3-like protein [Hypocrea jecorina]8e-10


Manual Annotation:

Please find below the necessary files for GSTUMT00011958001 annotation :

link to GSTUMT00011958001 Artemis file
link to scaffold_93 sequence file
link to scaffold_93ESTs