Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011904001
Length(AA) : 152
Localization : scaffold_92
Number of EST contigs matching the gene: 2
Number of ESTs : 12
  User annotation : No user annotation

Blast Results:

Nr Definition: predicted protein
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001537924.1| Score: 232 E_value: 3e-18
KEGG Definition: hypothetical protein ( (AL451017) related to MICROSOMAL GLUTATHIONE S-TRANSFERASE 3 [Neurospora crassa OR74A] )
Accession: ncr:NCU01320.1 Score: 229 E_value: 3e-18
KOG Definition: No Hit Found
PFAM Definition: MAPEG, MAPEG family. This family is has been called MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism). It includes proteins such as Prostaglandin E synthase. This enzyme catalyses the synthesis of PGE2 from PGH2 (produced by cyclooxygenase from arachidonic acid). Because of structural similarities in the active sites of FLAP, LTC4 synthase and PGE synthase, substrates for each enzyme can compete with one another and modulate synthetic activity..
Pfam Number: pfam01124 Score: 194 E_value: 3e-16
Swissprot: Q3T100|MGST3_BOVIN
Gene Ontology:
GO:0005789 = Cellular component: endoplasmic reticulum membrane
GO:0004364 = Molecular function: glutathione transferase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.344NO0.687NO0.302NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0480.4550.424S524

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=64.1424First60=21.1895PredHel=3
Topology=(12-34,80-102,124-143)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011904001
MPLSSVPQEYSYVLASLFAASLVSQYHTILVGGIRKAAKVPYPNAYASAE
DASKDKEKFRFNCAQRAHSNYLENLAVVLPAFLASALHYPIASSSLLGIW
LAGRVAYARGYAGSEHNGTGKGRYKGAFFYVGQIGLAVTATMSAWKLYSS
GP

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1322 predicted protein [Ajellomyces capsulatus NAm1]7e-18
SY0AAA23YM01FM1 predicted protein [Ajellomyces capsulatus NAm1]5e-17


Manual Annotation:

Please find below the necessary files for GSTUMT00011904001 annotation :

link to GSTUMT00011904001 Artemis file
link to scaffold_92 sequence file
link to scaffold_92ESTs