Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011875001
Length(AA) : 178
Localization : scaffold_91
Number of EST contigs matching the gene: 1
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001239480.1| Score: 790 E_value: 8e-83
KEGG Definition: hypothetical protein
Accession: ang:An01g08980 Score: 783 E_value: 3e-82
KOG Definition: Predicted membrane protein
Classification: [Function unknown].
Kog Number: KOG3319 Score: 547 E_value: 5e-57
PFAM Definition: ORMDL, ORMDL family. Evidence form suggests that ORMDLs are involved in protein folding in the ER..
Pfam Number: pfam04061 Score: 568 E_value: 2e-59
Swissprot: P53224|ORM1_YEAST
Gene Ontology:
GO:0005783 = Cellular component: endoplasmic reticulum
GO:0006986 = Biological process: response to unfolded protein

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.160NO0.510NO0.109NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5240.0660.427M518

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=40.2981First60=3.40539PredHel=2
Topology=(122-139,144-163)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011875001
MSDAAHGRRRRSSSLIYTEPPETIEQQSDQAALPNLNASWVNSKGAWTIH
VVLIIALKIFYDTMPGVSQETSWTLTNISYMAGSYLMFHWVQGIPFEFNA
GAYDNLNMWEQIDNGDQYTPTKKFLLTVPIVLFLMSTHYTHYDLTYFIIN
CLAVLAVVIPKLPSSHRMRVGLFTVPEE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1488 conserved hypothetical protein [Coccidioides immitis RS]5e-82


Manual Annotation:

Please find below the necessary files for GSTUMT00011875001 annotation :

link to GSTUMT00011875001 Artemis file
link to scaffold_91 sequence file
link to scaffold_91ESTs