Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011842001
Length(AA) : 420
Localization : scaffold_91
Number of EST contigs matching the gene: 1
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_03872
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001595782.1| Score: 552 E_value: 2e-54
KEGG Definition: hypothetical protein
Accession: mgr:MGG_00735 Score: 496 E_value: 2e-48
KOG Definition: RNA Methylase
Classification: [
Kog Number: KOG0838 Score: 268 E_value: 3e-24
PFAM Definition: SpoU_methylase, SpoU rRNA Methylase family. This family of proteins probably use S-AdoMet..
Pfam Number: pfam00588 Score: 288 E_value: 1e-26
Swissprot: P25270|MRM1_YEAST
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion
GO:0005515 = Molecular function: protein binding
GO:0008989 = Molecular function: rRNA (guanine-N1-)-methyltransferase activity
GO:0000154 = Biological process: rRNA modification

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.099NO0.258NO0.082NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.7040.0260.38M49

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01592First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011842001
MNTPQSARLLHKIPIKILYKPLHRSVSTDSAINRGLRRSAAADRYYGCQK
DTREYDYSPEPAIYQNSPPPLDPTIRRVVARREGEPKGDYFELEPRRELS
PRLDHEPPQFGYTPAPRRYIPKVNYDAEWIYGTSVVEAALRCKRRELYKL
YVYAGDNRTPAARERDRDMKDLARTAGVEIVDEEDMGKMDSMSNSRPHNG
YVLECLPIKRTPIIALKGVQEDRNFFTLEMARHYFDGRPVTEHYYDKIRC
RDPKRRYPFVLMLDEILDPGNMGAILRSAYFLGVDAVTITARNCARLSPV
CLKASAGAAELLPIFEHAKSERMITQSTENGWTVYAAIPPPTKNQARRDR
YVYAPEVAEVVKEGPVVLLVGNEGEGLRPPLKKLAKFCVSLVKGPGTDSL
VDSLNVSVATALLCSKFLGA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1566 hypothetical protein SS1G_03872 [Sclerotinia sclerotiorum 1980]2e-54


Manual Annotation:

Please find below the necessary files for GSTUMT00011842001 annotation :

link to GSTUMT00011842001 Artemis file
link to scaffold_91 sequence file
link to scaffold_91ESTs