Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011825001
Length(AA) : 524
Localization : scaffold_90
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_06998
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001554410.1| Score: 695 E_value: 6e-71
KEGG Definition: ankyrin repeat
Accession: aor:AO090113000090 Score: 642 E_value: 4e-65
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: Q00808|HETE1_PODAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.406NO0.665NO0.324NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0710.3760.535_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01311First60=0.00975PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011825001
MASFLVGHLKMQTGAIVCYFFFKDDSEEQRSATLALCAVLHQLFSQRKSL
CRYAGEALEARGEKFVEEVDTLWDILVKAVVDRECGQVICVVDALDECED
VTLAPLIHHVNRLLGPQTSKTPLKFLVTSRPYHNIEKELGSRATTIRLRG
EDEVSAITSDVTRVIDNGITELESIWRNPGGLKHLRNLLLSSADRTFLWV
SLVLQLMKDSHDGSAEEFTNIISTTPRDLAEFYTKILDRSSDPEKARRIL
HIVVAAARPLTLTEMNVAFRITRDHKSVRDPSGNIHDTFKKTMKNICGLF
VRVLDSKIYLVHQTAREFLIKGSLAGQGNWQYTLCPKDSNFVITDICISY
LSREEFAGSPLAINAWGGVSKEAVDDYLQKYSFLDYAARHWADHFRDSFR
HTEDRGMELFNFTRIICDAGPECCRTWFQVYWFNNQWYDIFPKDFTHLMI
ASLLGQARVVDRLLEEEGDVSARSEIHGTALNIAAVRRDEGITRKLLHKN
VRAYVGRKGYNILQVKARLAGSDS

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA57YL16FM1 hypothetical protein BC1G_06998 [Botryotinia fuckeliana B05.10]3e-32
SY0AAB39YC17FM1 hypothetical protein BC1G_06998 [Botryotinia fuckeliana B05.10]7e-24


Manual Annotation:

Please find below the necessary files for GSTUMT00011825001 annotation :

link to GSTUMT00011825001 Artemis file
link to scaffold_90 sequence file
link to scaffold_90ESTs