Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011780001
Length(AA) : 136
Localization : scaffold_9
Number of EST contigs matching the gene: 5
Number of ESTs : 214
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_10561
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001588115.1| Score: 195 E_value: 6e-14
KEGG Definition: hypothetical protein
Accession: mgr:MGG_00777 Score: 190 E_value: 1e-13
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.042NO0.059NO0.030NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1510.0450.883_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011780001
MTRTQKANDIPHNHPEAEAAFNEHQIPKFFGKSGHVDTAPNKTKKNGGGK
GNWGLAGDELQDLPDEYTVFKARRRSNSMGHIENMYVKSKFETLDDEPVF
DERIHGAVGPGVAEDGAELASTVSNSTNASVEGEKA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig211 hypothetical protein SS1G_10561 [Sclerotinia sclerotiorum 1980]2e-13
Contig1832 hypothetical protein SS1G_10561 [Sclerotinia sclerotiorum 1980]8e-13
Contig4626 hypothetical protein SS1G_10561 [Sclerotinia sclerotiorum 1980]7e-13
Contig5276 hypothetical protein SS1G_10561 [Sclerotinia sclerotiorum 1980]3e-13
SY0AAC41YL21FM1 predicted protein [Ajellomyces capsulatus NAm1]2e-06


Manual Annotation:

Please find below the necessary files for GSTUMT00011780001 annotation :

link to GSTUMT00011780001 Artemis file
link to scaffold_9 sequence file
link to scaffold_9ESTs