Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011697001
Length(AA) : 1659
Localization : scaffold_9
Number of EST contigs matching the gene: 5
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_11068
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001801319.1| Score: 3165 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: fgr:FG05929.1 Score: 2409 E_value: 0.0
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.098NO0.265NO0.078NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6420.0630.349M487

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03854First60=0.00105PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011697001
MTIAQGRHPSLKHRPSLPVSASAPSGQLPLLSGDSYISSVPSAFVGQTTS
LAELAHLVKLQSYQEHKHFQSRIRLHKSLVSSAVSARLTRSGELCHKALV
DYFKSDQKSDFATLYNALHDVRNSCEATRRFAMLEPELDSAKPSNSSDDN
EGPRGLTSFLHEIPVQARDTILSFISMIRSSPTFLANRLARLTNSELESL
VRHHYQPNPQESILPQQVPRRGNAASRNTTSQIPVPSPVERLLAFHRNDP
LYTILHTIFANSTGPDSAEDRRRTDVWATTCAKLICENKGESFLLVVMDS
WAAMREWPAKANLEICLMNLIQEGSFLVDENNGGSQADLRGKQDLLAEEF
WIKAEKKLLEVLDDEPSAGGIPEGILELGHAILQKIDDPKKQRQAEIILV
AKWFFQRFLTNGVAYPEYYGIMTGHHISEHARLKILRPVLKKIYNHAVGV
VFGDWKTNNPVEPVVRSHIENLLGRFRNPHPSDSTPVLLPTKAITSPRET
TEVQPFIVLCPADIVTLYRALYPQGSSAMVEGRDIRGTMGSRSSSRQIFG
KSPNAVFEIGSGSVLSGSGSSVTSESASMTYPLLERSSFPDDRRSFTSVP
LASPSSFSFNTQTFHPSSSDPNSLEKFGLEVRSAVEAMMGRLGPDVTSGK
CHPCAEKWAVIYVSPDGKELSLRMRKDWDEDDDDDDDEGHNSDSEDEAPL
EVSGLDRVYNQLKESVMKLVAEFEIPEEPVSENPKFSNRPSAAKANSAPS
VPTIPIVETVPETKLDPSNPFHPQSNLTAMITAGQSKAPAPDRSRGAALK
DNLDKPKQRAQTPPSLLFTMLQAASTQCLARGDYVSSQQYHRAVFQARKL
PPSLQRDEYAPLLHIFSRDPRDSIERSAAGIEECEAWFVWLTLAQERHET
AVDEMMRKIKDLRDKMWYVTDVRNSAAYDEARNVALALKKMGMPQRPKTD
TKTKSSSRNLSHRMSASSFSLLKSDTLIDILAAQPEHGGLNKLSDEQASM
TFEYLSRYSVENFCKGEERIHRFCLEIDKCVTKLVGDGILDGPVLWSSEL
FSRDDREMAINRQKGELYLAGVGTLSVSGDDDHEDGRVKRGLDMLRRPST
SDIFGRNRSASIVNSIHDLPSSRGKGRTKSNAGLMDSIDRQDLFGMPSPA
LQPETHNTYWSPFSSHSNNSSSGRPKTAHSPTSLSKSLETVNHQKRKFLG
ELKQSLTGLLLSDLGLEVFSKGSETDGWFSGGLGDECIQRKEEQEEAKRK
VPEKQSSKNSGGSGNKKLARKKSTKNVRKSANTGTFEALGKEKKGELAAP
VATLENVGREAHSGEENSSSSDATARTSTLSAAKKGGFMAFPYGHAFRRL
LMQFSTHPNPFQKLQAIYELELLIVASLSARSPSCMRKPTLPSMPSSPFL
EAMGEASSRICSLQLNQPSNIEEAMANLEERRSNVMNSGAVASPLMTPSG
ARSPTHTAAPSADMIVEVLQDLFRQAEIRPKTLFRDLQFVAAFVPASILD
RTAIGKAFWDTGLAALGLKQDVCRTMAEIADEIVAKDTTQRESESGKEKG
NKGENKEYSRYTMQDAATMWNIAAKEGDPAAQRELAIFYLTNPTLLPRST
KPLSKPKDTFRPEMMVAKGEDPEKRDPATMCVAYHWMELSAQGGDELARK
YLRSQREEW

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1594 hypothetical protein SNOG_11068 [Phaeosphaeria nodorum SN15]1e-25
Contig2147 hypothetical protein SS1G_10054 [Sclerotinia sclerotiorum 1980]1e-68
SY0AAA58YK05FM1 hypothetical protein SNOG_11068 [Phaeosphaeria nodorum SN15]2e-10
SY0AAC11YG06FM1 hypothetical protein SNOG_11068 [Phaeosphaeria nodorum SN15]3e-45
SY0AAD2YO04FM1 hypothetical protein SNOG_11068 [Phaeosphaeria nodorum SN15]7e-30


Manual Annotation:

Please find below the necessary files for GSTUMT00011697001 annotation :

link to GSTUMT00011697001 Artemis file
link to scaffold_9 sequence file
link to scaffold_9ESTs