Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011690001
Length(AA) : 399
Localization : scaffold_9
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE61619.1| Score: 675 E_value: 8e-69
KEGG Definition: tRNA splicing endonuclease SEN2 [EC:3.1.27.9]; K01170 tRNA-intron endonuclease
Accession: aor:AO090102000604 Score: 675 E_value: 4e-69
KOG Definition: tRNA splicing endonuclease SEN2
Classification: [Translation
Kog Number: KOG4685 Score: 338 E_value: 2e-32
PFAM Definition: tRNA_int_endo, tRNA intron endonuclease, catalytic C-terminal domain. Members of this family cleave pre tRNA at the 5' and 3' splice sites to release the intron EC:3.1.27.9..
Pfam Number: pfam01974 Score: 115 E_value: 2e-06
Swissprot: Q8TFH7|SEN2_SCHPO
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.143NO0.554NO0.146NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3230.1820.321M575

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.43221First60=0.39184PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011690001
MTSSPPLSTTAPTRYKKPNYHLLHALPLPLSVSPLPPLIPHNPLSLIHII
IAYLFPSNPSHPSPLHRGFFHASTRSVHITDPETIKAFWNHGFFGKGNLS
RSEPTWVTRRRRALGVIGRDEALTAEEVTERRRGERKEFKKERARLEKEK
LDRQLAEEGKLNPEGNEDQEGTGSGSSSSAARAVHFAPLESPSSRRRSLE
RPVADVEDIEHLQLTLEEAFFLSFGLGVLELTDADTNKKISQKDMLRLFR
GHACFPPRDPQSSFEPDDPFMLSYVVYHHFRSLGWVVKPGVKFAVDYLLY
NRGPVFSHAEFGVLILPAYSHTHWANDKSRKEGKELRPWHWLHSINRVSS
QVKKTVVLVFVEVPPPLDDDGKIGVADLLARYSVREVALRRWLVSRNRD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1210 tRNA-splicing endonuclease subunit Sen2 [Schizosaccharomyces pombe 972h-]2e-16


Manual Annotation:

Please find below the necessary files for GSTUMT00011690001 annotation :

link to GSTUMT00011690001 Artemis file
link to scaffold_9 sequence file
link to scaffold_9ESTs