Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011684001
Length(AA) : 524
Localization : scaffold_9
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_05569
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001555894.1| Score: 977 E_value: 1e-103
KEGG Definition: hypothetical protein
Accession: ani:AN8806.2 Score: 958 E_value: 1e-102
KOG Definition: Ceramide glucosyltransferase
Classification: [Lipid transport and metabolism
Kog Number: KOG2547 Score: 365 E_value: 2e-35
PFAM Definition: Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids..
Pfam Number: pfam00535 Score: 128 E_value: 8e-08
Swissprot: Q16739|CEGT_HUMAN
Gene Ontology:
GO:0005624 = Cellular component: membrane fraction
GO:0008120 = Molecular function: ceramide glucosyltransferase activity
GO:0008544 = Biological process: epidermis development
GO:0006679 = Biological process: glucosylceramide biosynthetic process
GO:0006688 = Biological process: glycosphingolipid biosynthetic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.393NO0.944YES0.383NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1930.6030.189S347

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=82.5666First60=22.1454PredHel=4
Topology=(32-54,377-399,414-436,463-485)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011684001
MASSPLSVVPLPPPGHGGSSNMFHFAPSAVQVILARVFLSWFVFVWAVCM
VGHVRMKRMYSRPPPSVPVTHGVSEALPYVSILRPVKGLDPFLQLCLEST
TLLRYPKSKYELILCVASPHDPAVPIIRQVIASHPEANARILIGEEDVGP
NPKIRNLSKGYREAKGDIVWILDSNIWVPSGILDRSVRLLEGLDQDGKGY
KLVHHLPLCVDVSNNYRQPPSIPSSPVISAGNSLTPLLPQPIAPSPPKPF
WSRWWAMGGGRLEESFLASSHCKFYTAINTLGVAPCVVGKSNLFRRSHLA
QVTRDPHGRPEKDGVLAFAEHICEDHLLAERLWLKPVDDEKSKVRVWGRH
GTGEDIVLQPVSRMPVVEYLARRTRWLRVRKYTVLAATLLEPGTESLLCS
FLGAYAMTTLPFFRSCIPPTWPALFMCWGIATILWAATDYSLFMFLHAYK
VIHPDEHTPEFVTEMPKRTFLEWVVQWIGREALAFGIWAWALWPGEVNWR
GGRYKVRWKDCRVEEIGRSIEKKD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4053 hypothetical protein SNOG_15502 [Phaeosphaeria nodorum SN15]7e-42
SY0AAC27YN11RM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00011684001 annotation :

link to GSTUMT00011684001 Artemis file
link to scaffold_9 sequence file
link to scaffold_9ESTs