Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011585001
Length(AA) : 379
Localization : scaffold_88
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_01881
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001559725.1| Score: 615 E_value: 7e-62
KEGG Definition: hypothetical protein
Accession: fgr:FG10425.1 Score: 595 E_value: 7e-60
KOG Definition: Uncharacterized conserved protein
Classification: [General function prediction only].
Kog Number: KOG2966 Score: 132 E_value: 2e-08
PFAM Definition: DUF607, Protein of unknown function, DUF607. This family represents a conserved region found in several uncharacterised eukaryotic proteins..
Pfam Number: pfam04678 Score: 139 E_value: 3e-09
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.212NO0.594NO0.162NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5890.1480.242M4112

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=41.8129First60=0.9146PredHel=2
Topology=(235-254,264-286)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011585001
MRETTYAGVGSIKAGVRVVLVVRYFTPQNSHILSLILTLQSQGKLLPTPS
QLLKLLLPLQLTGSSHPTDPPLALLVHPLQPLSYLQCLIQAELPPITSPN
SAPRAPSISFKAVDLGDTLLEVHTNTKSRRKLQSLGGWKGEGGAETVGGL
SSLSPSERSGKGGYVRWSASTEVGDFVRDVARGTEFVIEIEGSDDVPVSM
PSFRQRTHYLRQRLVAAAREIELQSRVESGSDGAAQRVAISGFAGLVGWW
VGVYWLTFKTGLGWDVMEPVAYLVGLSTVIVGYLLLLYGGREVPCRSVPR
MDVSKRRMKLYREKGFGVDKWQELVNEGRALRKEIKAIAEEYDVDWDERS
DGVGGDKVINPLAEGARGGEGEGRGTQKW

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1484 hypothetical protein BC1G_01881 [Botryotinia fuckeliana B05.10]1e-20


Manual Annotation:

Please find below the necessary files for GSTUMT00011585001 annotation :

link to GSTUMT00011585001 Artemis file
link to scaffold_88 sequence file
link to scaffold_88ESTs