Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011571001
Length(AA) : 237
Localization : scaffold_88
Number of EST contigs matching the gene: 1
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein FG10037.1
Specie: [Gibberella zeae PH-1]
Accession: ref|XP_390213.1| Score: 567 E_value: 1e-56
KEGG Definition: hypothetical protein
Accession: fgr:FG10037.1 Score: 567 E_value: 6e-57
KOG Definition: Serine/threonine protein kinase
Classification: [General function prediction only].
Kog Number: KOG3087 Score: 634 E_value: 5e-67
PFAM Definition: Kdo, Lipopolysaccharide kinase (Kdo/WaaP) family. These lipopolysaccharide kinases are related to protein kinases pfam00069. This family includes waaP (rfaP) gene product is required for the addition of phosphate to O-4 of the first heptose residue of the lipopolysaccharide (LPS) inner core region. It has previously been shown that WaaP is necessary for resistance to hydrophobic and polycationic antimicrobials in E. coli and that it is required for virulence in invasive strains of S. enterica..
Pfam Number: pfam06293 Score: 124 E_value: 8e-08
Swissprot: Q4HYC1|BUD32_GIBZE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.055NO0.232NO0.062NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0830.1180.853_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.06469First60=0.05923PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011571001
MSSTEIDPPTPKFLIKQGAEALVYRTTYLLPHIPALLKHRPSKQYRHPTL
DARLTKHRCLSESRLLIRARSLRIPVPAVYFVDESRGEIFMEWISGSSVR
EVLDEVLAQEGGEAMVDRMMVKVGVAVGALHAADIVHGDLTTSNIMVRNG
EGEGIVGFGEKEVVLVDFGLGTVSTQDEDKAVDLYVLERAFTSTHPKAEK
LFHDVLKSYEQSYKGANVVLRRLQDVRMRGRKRSMIG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1000 hypothetical protein CHGG_00516 [Chaetomium globosum CBS 148.51]5e-44


Manual Annotation:

Please find below the necessary files for GSTUMT00011571001 annotation :

link to GSTUMT00011571001 Artemis file
link to scaffold_88 sequence file
link to scaffold_88ESTs