Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011560001
Length(AA) : 319
Localization : scaffold_88
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein FG01175.1
Specie: [Gibberella zeae PH-1]
Accession: ref|XP_381351.1| Score: 924 E_value: 8e-98
KEGG Definition: hypothetical protein
Accession: fgr:FG01175.1 Score: 924 E_value: 4e-98
KOG Definition: Protein required for biogenesis of the ribosomal 60S subunit
Classification: [Translation
Kog Number: KOG3031 Score: 940 E_value: 1e-102
PFAM Definition: Brix, Brix domain..
Pfam Number: pfam04427 Score: 292 E_value: 3e-27
Swissprot: Q9UUG1|BXDC1_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005730 = Cellular component: nucleolus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.086NO0.286NO0.058NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6590.0220.508M523

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.265First60=0.00102PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011560001
MIRTTKPRNARSKRALEARECKLVENQKSALFLSGTSTSDLTRSAMTDIH
SLKKPNAIKFTKKNSIHPFEDATPLEFFSSKNDTSFLVFASHSKKRPHNL
TIARTFDHRILDMLELGIDESTFRPLTFFKTSKPGIGMKPLLSFSGAIFD
SIPNYRLFKSMFLDFFRGETVNSVNVEGLQYMIHFSAAESTEQNPAPAIH
MRVHLIKTLKSGQKLPRVEVEEMGPRIDFRIRRVHEPDEAMMKEALKKPR
ALEARSKKNIETDIMGDKIGRIHTGGQDFSKMQSRKMKGLKRRPTDEADE
EMTLVDEDEDGGAKKARLA

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB10YF03FM1 hypothetical protein FG01175.1 [Gibberella zeae PH-1]2e-51
SY0AAB33YO18FM1 hypothetical protein FG01175.1 [Gibberella zeae PH-1]9e-52


Manual Annotation:

Please find below the necessary files for GSTUMT00011560001 annotation :

link to GSTUMT00011560001 Artemis file
link to scaffold_88 sequence file
link to scaffold_88ESTs