Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011536001
Length(AA) : 1840
Localization : scaffold_87
Number of EST contigs matching the gene: 5
Number of ESTs : 17
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_03625
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001794180.1| Score: 2918 E_value: 0.0
KEGG Definition: proteasome component (Ecm29), putative
Accession: afm:AFUA_6G06540 Score: 2767 E_value: 0.0
KOG Definition: Uncharacterized conserved protein
Classification: [Function unknown].
Kog Number: KOG0915 Score: 1495 E_value: 1e-166
PFAM Definition: No Hit Found
Swissprot: P38737|ECM29_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0005634 = Cellular component: nucleus
GO:0000502 = Cellular component: proteasome complex
GO:0005515 = Molecular function: protein binding
GO:0030163 = Biological process: protein catabolic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.036NO0.126NO0.030NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0350.1650.953_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.02024First60=0.00757PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011536001
MTSLDVDGDKELRLVNNVELKIALADTDEKLQRLLNLYLPPLILKLASPH
ASVRNKVISICQHVNTRIRPVTIILPVAALLKQFKDPEIGGRYSLVRNFD
LMYVQTGIERLPVSERLELLPPLLKDISKHDNVIHQRSLFDILLKVLVHF
EPPNRGTQDDLALRTKMGFHEGSGGEDAVWVAGWFKRLMLLNLSVFASSN
TSGQLNCPGISAGEFDFLTLGGKKETFSPFAVLTDIKKAVLRFLASGAFT
DQERFFPSLVGASDTNSAVAEPAEDVFKRSLPSVSLDDGGVVQELYQLYF
GNPGNAIPPVKVVLQARIVGLLAKSTEAIGEQWGNQIVKIVESGLETDYS
RLRQAAFTFVNWASRMGGGKVMAAVAVDVVEKIRYWLLSTSPEDGGGAGG
DDLRGYAYESLGLLVKRAPGIVVEKDWRILKFLFGRLRDEPAGSVAVSVE
GALATLLPTIAKQPLDRETEESLEELIIEQMIAGKGRSTRFSAVRYANRI
LEFGNVEGRWVNLLALGRKGERDEVVEEAKKGLHPYYYRLINPEESYPVA
TDENSMEIDTPEAKKPNKYTFPSFSDLINYLFPHSAQSATTWTAQESIVA
GLMPPEVFATAVSFCRRVGLMEALGNEEVVVDEDWERKLDAAVERDEGIR
HKVQIYFSKLGEENSCILNRFMEVAWLGMVWDGSGLDGIRDVWVDLVGVV
PEKSWENSVRKLESLKTAVLTGTKSEDRVVASRALGIVGSHEALGENILL
SMTEEMVTYAHGLDKTFGVESGKVHGGILTLGFLLSRLKLRGRLGSLPKE
LVHKAVGVLVNALLEARDQTILDAAVQSFSEISIFAVVHGDYFRKTYAGI
LDRLTELGKKGKEKAVLAIGHLAIVFPSSDKPIIDKLLQALFAFHENRQV
EINFATGEAIACLAGGWQSKSVRGKVDIAGYENAKPAEELAKWRLGEVLE
AVLGKVSDTKPSLRKAVCVWMLCLLEFCGEEQQVKSKLGEMQKGFRGYLV
DRDELVQETAARGLTMVYEKGEKETKDDLVRNLVSSFTGEKTRTLAGNVS
AETELFEPGALPTGDGSISTYKDIMSLASEVGDPSLVYKFMSLARHNSLW
SSRAAFGRFGLGSILSSSDVLKHNPKLYPKLYRYRFDPNPNVARSMEDIW
KALVGSDERNVLEAQFDNIIEDLLKYAVGREWRTREASCNALGELVQGKK
IDEYKPYLEKIWSTSFRVLDDVKESVRIAAMKLCRGLTQAMVHNVDMASG
GSRKEAEAILEGVMPFLMGGRGLEAEAKEVQLFALRTLLQLVKAGGPVLL
PYIPDLVDKFVQLLSSLEPEVVNYLHLNADKYNTTGDDIDRIRLAQVRAS
PMMDAIERSLDLLDRDTMKVFVPRFEKTIRKALGLPSKVGCSRIIVTLVV
RHGSIAKPFADELLKTMQTSMHDRNETVMASYASAAGYLCRLASDEKILS
FVGYSRKLYFEGEDEKPRALASEMVYSLCKNATDRFNSLAVDILPFIFVG
KHDPHTSIAEVFTKAWTENTGGTGAIKLYFGEIISLAQTHLSSPRWALKQ
TAALSLADTCKSIGKDVTTDQVDLLWPVLVSATSGKSWDGKEAVLDALVS
LAANAVQYFENDQAKLQELSTIVLREARRKNAAYRSIAIKSLGDFANGFA
ALNLFEEVYDIVVDSVKDESEDKMDVDVAADGRSLKTIEERTLANGLVTL
CQAFRPDSNSKGAKARADALKTFEFVQAKLAGANYDLKIRGIGGIATVLR
RLSTTTLGEQDWNDVLGKAWFQVNQCLTDRSNENVRIKAAEATMQMLKLQ
GHGSLWDDVRVDLQLALADEHSPMVRQALGTDFERFVREG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig202 hypothetical protein SNOG_03625 [Phaeosphaeria nodorum SN15]6e-74
Contig1214 conserved hypothetical protein [Ajellomyces capsulatus NAm1]1e-70
Contig1801 No hit found
Contig2712 conserved hypothetical protein [Ajellomyces capsulatus NAm1]1e-39
SY0AAC37YC01FM1 hypothetical protein [Yarrowia lipolytica]1e-24


Manual Annotation:

Please find below the necessary files for GSTUMT00011536001 annotation :

link to GSTUMT00011536001 Artemis file
link to scaffold_87 sequence file
link to scaffold_87ESTs