Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011525001
Length(AA) : 602
Localization : scaffold_87
Number of EST contigs matching the gene: 3
Number of ESTs : 5
  User annotation : TmelCRZ1-2  [+]

Blast Results:

Nr Definition: hypothetical protein ATEG_04274
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001213452.1| Score: 375 E_value: 9e-34
KEGG Definition: C2H2 zinc finger protein
Accession: afm:AFUA_7G03910 Score: 371 E_value: 1e-33
KOG Definition: Ovo and related transcription factors
Classification: [Transcription].
Kog Number: KOG3576 Score: 211 E_value: 2e-17
PFAM Definition: Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo..
Pfam Number: pfam05109 Score: 141 E_value: 3e-09
Swissprot: P53968|CRZ1_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0005634 = Cellular component: nucleus
GO:0003700 = Molecular function: transcription factor activity
GO:0019722 = Biological process: calcium-mediated signaling
GO:0006355 = Biological process: regulation of transcription
DNA-dependent

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.054NO0.093NO0.047NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3120.0340.781_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.09333First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011525001
MASQFSGTNGTDIKTSAAPAGSSKTLPPLSTKSPTLTPQGQLTGAAILNR
QRSTSPKTMSTEHKNTPTTTTTTPAANELPKQSPNPAALLTAGFGMSAPT
DVPKEEPTPSRELGSLPGVAAAAAAMEERESPTATTMSGTDSAGLTTAAP
PQVTTPLLLQEQYPPLQPQPPPQTQTQQPRDQKDTGTPGTSQYGHNPTTP
VTPFSPSGSSAGARGKHTCSHCLKTFTRHHNLKSHLLTHAHEKPYLCTTC
QARFRRLHDLKRHSKLHTGERPHVCNKCGRRFARGDALARHARGEGGCAG
RRGSMSGLNEDGSMGVGGEREDDIGDLEGLMDDPDGDVMMDDVGSPAGTG
GNAAAGGGRRRQSLPSLRTDLPNTPMTPASAYTTAATPLNPNSSTSTASS
SATLTGRHPHHLHHHHPHHHPHHNTYPPPSARSLAAVSATTNPQSATSTT
SSSTPGQTALSASAPSPPLFSSGISFNRTPAPVTTPTPSSATAAPTTTAA
TATSNTVLSPAGVLTDSPGAVSPGMTRERTPSFTSSGGFLSPPGPVMASS
GAAGGRTSGTGTAGGGVGSSNVFASGMDGVWAYIRTLEDRIRVLEERAGS
RE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1156 No hit found
SY0AAA22YL12FM1 No hit found
SY0AAD48YB06FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00011525001 annotation :

link to GSTUMT00011525001 Artemis file
link to scaffold_87 sequence file
link to scaffold_87ESTs