Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011499001
Length(AA) : 459
Localization : scaffold_86
Number of EST contigs matching the gene: 1
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_01351
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001247580.1| Score: 171 E_value: 3e-10
KEGG Definition: conserved hypothetical protein
Accession: afm:AFUA_5G14200 Score: 153 E_value: 2e-08
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.056NO0.193NO0.047NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4190.0610.562_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01814First60=0.00144PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011499001
MLGSSSTHLTPYSTQPSTGKTSLLTQRLHQGGAVMKILPASSILKALLDT
EGRQNTHRLPRTKASARARASTMSKPIPLPSPPTSPPRPLSENATAATTT
APPLPLREMVISPVGDILLHLLTPTHTLHYKTSASVLITTSKVFSAMLSP
TSPFSEAQRFNNSPHSTHPFVLRLHDDDPVALCILLKALHNHPSVPRSLT
FRQLVKMAVVVDKYDCSHATRMYGDKWMKGWTSKAEKAGYEEWLFVSWVW
GVEKIFGKLFGKVVKEVCVQRVGGGMDKIPVLKERKGGGGFEEYVPESVL
KAILNHRSNLLTHLKTVFASLFERYRPSPSLSQLSPQCAATPPDPRCDAL
VFFSVYRKLSELNLLPWNTIDDLDGFTIDELVGWILHTTPSSSISGAGGG
MRLLSLEKHGKACNPLEQLAAQVKLAMAASGGNGERDVWEFRAREEESSW
EEIGKEVGI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1599 conserved hypothetical protein [Neosartorya fischeri NRRL 181]1e-09


Manual Annotation:

Please find below the necessary files for GSTUMT00011499001 annotation :

link to GSTUMT00011499001 Artemis file
link to scaffold_86 sequence file
link to scaffold_86ESTs