Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011434001
Length(AA) : 454
Localization : scaffold_84
Number of EST contigs matching the gene: 1
Number of ESTs : 4
  User annotation : TmelPLC3  [+]

Blast Results:

Nr Definition: hypothetical protein SS1G_06734
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001592493.1| Score: 826 E_value: 3e-86
KEGG Definition: phosphatidylinositol phospholipase C [EC:4.6.1.13]; K01771 1-phosphatidylinositol phosphodiesterase
Accession: afm:AFUA_4G12000 Score: 775 E_value: 1e-80
KOG Definition: Glycosylphosphatidylinositol-specific phospholipase C
Classification: [Signal transduction mechanisms].
Kog Number: KOG4306 Score: 155 E_value: 5e-11
PFAM Definition: PI-PLC-X, Phosphatidylinositol-specific phospholipase C, X domain. This associates with pfam00387 to form a single structural unit..
Pfam Number: pfam00388 Score: 159 E_value: 2e-11
Swissprot: P14262|PLC_BACCE
Gene Ontology:
GO:0004436 = Molecular function: phosphatidylinositol diacylglycerol-lyase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.059NO0.155NO0.044NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.390.0370.729_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.02392First60=0.0008PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011434001
MAHENLTIRNLSSTEISVTRVSRFPDPGPQPVTIKNITNIKNLAHNFTSF
VAKAIPPPGEPSSQTIAENAQAFSEEDASIRLPAFAIVQTDIKINKDQVV
RLAFTVGEARFRVDLSSHTPAVHCLSPGTEHKFNAVFHRNHSHLALLSSA
ALGGWMERLKDETPLSLISIPGTHNTPTCYPALPTVRCQAVGPKQQLENG
IRFFDIRCHVDRANALTLVHGAFPISLVGCKGLSEVLKDAYSFLDGNPHE
CIIVSLKREGRGDADDAKFAKVLKEGYIDKEASRWYLEDSIPTLGQVRGK
VILFRRFTLPSDIHQFGINAEHWDYNTPDSSTSSRICRVQDFCEVEPATI
SKKITYVKEHLERSAKPLEPGTTRQLFVNFLSASNFWKVRCWPDKIADKV
NVETLRHLAIDHVAGREQGDGSTGLVICDFVGEDGDWELVRLIVAMNGWI
KKTG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1409 hypothetical protein SS1G_06734 [Sclerotinia sclerotiorum 1980]2e-43


Manual Annotation:

Please find below the necessary files for GSTUMT00011434001 annotation :

link to GSTUMT00011434001 Artemis file
link to scaffold_84 sequence file
link to scaffold_84ESTs