Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011427001
Length(AA) : 312
Localization : scaffold_84
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : TmelZAP1-3  [+]

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001210304.1| Score: 574 E_value: 3e-57
KEGG Definition: Zn-finger
Accession: aor:AO090038000401 Score: 570 E_value: 4e-57
KOG Definition: C2H2-type Zn-finger protein
Classification: [Transcription].
Kog Number: KOG2462 Score: 144 E_value: 5e-10
PFAM Definition: No Hit Found
Swissprot: Q9UTM0|YIV2_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0003700 = Molecular function: transcription factor activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.063NO0.163NO0.071NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.620.030.469M537

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011427001
MSSPPSSLSSFSSMDSPPPTLPRTPVKRAASAAFSDQPETSPTLTHHHSH
PNFSDISSDTSGSVPGSPMEAEEIEHAEQVTMCKWDSCDMDMGNMDDLVK
HIHDEHIGLRRAKYACEWDDCNRKGMAHASGYALRAHMRSHTKEKPFYCT
LPECDRSFTRSDALAKHMRTVHETEALRPSDPIPKSHPNHPQNIHQPNTA
ATSHSTASSPSSPTSSTKNASKNGASKWYTSEDGFDPDEEAMPPRELMRL
LKKKLAWSEQEQEELKRKLEELEKKRREGWIKKEMLLDRVLAQELGEEEA
AELSLDVPMPDA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1872 hypothetical protein An08g02190 [Aspergillus niger]4e-27


Manual Annotation:

Please find below the necessary files for GSTUMT00011427001 annotation :

link to GSTUMT00011427001 Artemis file
link to scaffold_84 sequence file
link to scaffold_84ESTs