Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011376001
Length(AA) : 387
Localization : scaffold_83
Number of EST contigs matching the gene: 1
Number of ESTs : 4
  User annotation : Tmelktr1b  [+]

Blast Results:

Nr Definition: glycosyltransferase family 15 protein
Specie: [Laccaria bicolor S238N-H82]
Accession: gb|EDR02459.1| Score: 992 E_value: 1e-105
KEGG Definition: KTR1; Alpha-1,2-mannosyltransferase involved in O- and N-linked protein glycosylation; type II membrane protein; member of the KRE2/MNT1 mannosyltransferase family [EC:2.4.1.-]; K03854 mannosyltransferase
Accession: sce:YOR099W Score: 988 E_value: 1e-105
KOG Definition: Glycolipid 2-alpha-mannosyltransferase (alpha-1
Classification: [
Kog Number: KOG4472 Score: 1273 E_value: 1e-141
PFAM Definition: Glyco_transf_15, Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi..
Pfam Number: pfam01793 Score: 1248 E_value: 1e-138
Swissprot: P27810|KTR1_YEAST
Gene Ontology:
GO:0005794 = Cellular component: Golgi apparatus
GO:0000026 = Molecular function: alpha-1
2-mannosyltransferase activity
GO:0000032 = Biological process: cell wall mannoprotein biosynthetic process
GO:0006491 = Biological process: N-glycan processing
GO:0006493 = Biological process: protein amino acid O-linked glycosylation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.021NO0.043NO0.021NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1990.040.839_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01957First60=0.00017PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011376001
MIHSKNTNPNEALEVGFRASDHARKSNGAYSAPGSVSHVKPAPVGRPPKP
KPAKDTRQIGKEKATLVMLVRNSELKDALGSMKQIEDRFNRHYQYPWTFL
NDEPFTEGFKNHTTRMASGTTEYGLIPKEQWSMPDWISEDKFQKVISKMS
KENVIYGDSRTYRHMCRYNSGFFFRDKLLAKYDWYWRVEPSIGFYCDMTY
DPFTFMRENKKRYSFVISLPEYLPTIETLWKTTQEFAKLHPEHIARNNSL
GFIATDPDKGIQETDYNLCHFWSNFEIADLNFWRGEAYQKYFEFLDKKGG
FYYERWGDAPVHSIAAALFLPRDQIHFFGDVGYKHVPWGRCPLDDESHDT
ARCMCPFDRKESFDYNQWSCQNKWNKFCGFPENPIYE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3863 hypothetical protein CC1G_04235 [Coprinopsis cinerea okayama7#130]1e-102


Manual Annotation:

Please find below the necessary files for GSTUMT00011376001 annotation :

link to GSTUMT00011376001 Artemis file
link to scaffold_83 sequence file
link to scaffold_83ESTs