Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011237001
Length(AA) : 369
Localization : scaffold_80
Number of EST contigs matching the gene: 2
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001208500.1| Score: 905 E_value: 2e-95
KEGG Definition: hypothetical protein
Accession: ang:An02g04050 Score: 891 E_value: 3e-94
KOG Definition: Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases
Classification: [Signal transduction mechanisms
Kog Number: KOG2283 Score: 343 E_value: 6e-33
PFAM Definition: DSPc, Dual specificity phosphatase, catalytic domain. Ser/Thr and Tyr protein phosphatases. The enzyme's tertiary fold is highly similar to that of tyrosine-specific phosphatases, except for a "recognition" region..
Pfam Number: pfam00782 Score: 113 E_value: 3e-06
Swissprot: O08586|PTEN_MOUSE
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0051717 = Molecular function: inositol-1
3
4
5-tetrakisphosphate 3-phosphatase activity
GO:0030165 = Molecular function: PDZ domain binding
GO:0016314 = Molecular function: phosphatidylinositol-3
4
5-trisphosphate 3-phosphatase activity
GO:0051800 = Molecular function: phosphatidylinositol-3
4-bisphosphate 3-phosphatase activity
GO:0004438 = Molecular function: phosphatidylinositol-3-phosphatase activity
GO:0004722 = Molecular function: protein serine/threonine phosphatase activity
GO:0004725 = Molecular function: protein tyrosine phosphatase activity
GO:0001525 = Biological process: angiogenesis
GO:0048738 = Biological process: cardiac muscle development
GO:0007417 = Biological process: central nervous system development
GO:0043542 = Biological process: endothelial cell migration
GO:0006917 = Biological process: induction of apoptosis
GO:0046855 = Biological process: inositol phosphate dephosphorylation
GO:0043066 = Biological process: negative regulation of apoptosis
GO:0030336 = Biological process: negative regulation of cell migration
GO:0008285 = Biological process: negative regulation of cell proliferation
GO:0051895 = Biological process: negative regulation of focal adhesion formation
GO:0051898 = Biological process: negative regulation of protein kinase B signaling cascade
GO:0046856 = Biological process: phosphoinositide dephosphorylation
GO:0006470 = Biological process: protein amino acid dephosphorylation
GO:0031647 = Biological process: regulation of protein stability

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.035NO0.108NO0.050NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1170.1940.766_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.05644First60=0.00079PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011237001
MSVPAAEFPKKAYRNPLDQVVKFLDSKHGQGWRIWEFRAEGTGYKDEDVF
GRIFHAPFPDHHPPPFALVPAVLASMRNHLKGEGRENAVAVIHCKAGKGR
SGTMSCAYLIGEEGWSADDALKHYTTVRMRPGFGEGVSIPSQRRWTRYIE
RWARELNKQYLERTIRIEEVHIHGLREGVRVAIQGFVDEGKEIKTYHTFT
RGEQITLDSNETSSSRNAILKPKHPVILPANDINIDFEKRNIAAYGWSMV
TSIAHVWFNAYFEGGEDSGLFEIEWEAMDGIKGTLRKGMRAFDRLKVVWS
VDRSTEHIVREPSEGEPIPQPRRAETKLLHERNLGLKRKDDTASPASGSS
GGSGVSLVNSTELLKAKDS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1485 dual specificity phosphatase, catalytic domain protein [Aspergillus clavatus NRRL 1]2e-33
Contig1639 hypothetical protein SS1G_13241 [Sclerotinia sclerotiorum 1980]1e-49


Manual Annotation:

Please find below the necessary files for GSTUMT00011237001 annotation :

link to GSTUMT00011237001 Artemis file
link to scaffold_80 sequence file
link to scaffold_80ESTs