Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011236001
Length(AA) : 568
Localization : scaffold_80
Number of EST contigs matching the gene: 3
Number of ESTs : 4
  User annotation : Tmelgpi10  [+]

Blast Results:

Nr Definition: mannosyltransferase, putative
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001271806.1| Score: 1150 E_value: 1e-123
KEGG Definition: hypothetical protein
Accession: ang:An04g04110 Score: 1149 E_value: 1e-124
KOG Definition: GPI-alpha-mannosyltransferase III (GPI10/PIG-B) involved in glycosylphosphatidylinositol anchor biosynthesis
Classification: [Cell wall/membrane/envelope biogenesis
Kog Number: KOG1771 Score: 1034 E_value: 1e-113
PFAM Definition: Glyco_transf_22, Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localised in endoplasmic reticulum and involved in GPI anchor biosynthesis..
Pfam Number: pfam03901 Score: 843 E_value: 9e-91
Swissprot: Q4WPG0|GPI10_ASPFU
Gene Ontology:
GO:0005789 = Cellular component: endoplasmic reticulum membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.601YES0.958YES0.669YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3170.4760.068S531

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=163.626First60=20.1422PredHel=8
Topology=(10-29,126-148,200-222,234-256,288-310,317-339,344-366,373-390)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011236001
MSPKSPDPRVLRFSSTSLIFFSILSFRLLNALTIRTFFQPDEFFQSLEPA
WKMVFGEGWLTWEWKNQLRSIAHPALFAAIYKSVNFISNLIGLQTSTKAE
VLAVAPKVLQAVFAALGDYFTAKLAGKLFGGAAGWTSLWFSVGSAFHFFC
STRTFSNSLETSMTTTALYYWPWPQLITKERGAKSVVVEGQIDRKELQLS
LLFAAFACILRPTNVLIWSSLGLFLIYHSSSRDRVRIVTEVVTVGFTALV
LNAVADHQYYGVWTFPPMKFLEFNLVQSLSVFYGSNPWHYYLSQGLPLLL
TSFLPVTMYALYSFLSRSLMEHGTAAGFQLASTTVLVTSVYSLISHKEFR
FIYPLLPILHVLSAAKFENLSWRTSTKKWVLIGMIVLNIPVAWYSTQVHQ
RGVVDVVEWLRKTGNADNPEKWNSVGFLMPCHSTGWRSSVMGDGEMWALE
CEPPIGLSSEERLAYLDEADRFYASPTEFLETKFPTPPSTGRNPMKRMLE
EKTHQWPDRLVFFGALEDIIKSYLGPDTEYEECKRFFNSHAHDDSRREGD
VIIYCLRKGAAGGAGSFI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1211 hypothetical protein CIMG_07963 [Coccidioides immitis RS]7e-67
SY0AAA23YL20FM1 hypothetical protein [Yarrowia lipolytica]2e-21
SY0AAB48YC01FM1 hypothetical protein An04g04110 [Aspergillus niger]5e-20


Manual Annotation:

Please find below the necessary files for GSTUMT00011236001 annotation :

link to GSTUMT00011236001 Artemis file
link to scaffold_80 sequence file
link to scaffold_80ESTs