Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011228001
Length(AA) : 451
Localization : scaffold_80
Number of EST contigs matching the gene: 1
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_09780
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001551510.1| Score: 811 E_value: 2e-84
KEGG Definition: hypothetical protein
Accession: mgr:MGG_06021 Score: 734 E_value: 7e-76
KOG Definition: Predicted GTPase activator protein
Classification: [Signal transduction mechanisms].
Kog Number: KOG2595 Score: 589 E_value: 2e-61
PFAM Definition: No Hit Found
Swissprot: Q2T9Q1|TBC20_BOVIN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.020NO0.040NO0.020NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1770.0530.852_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=27.8008First60=0PredHel=1
Topology=(380-402)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011228001
MKDEKLSSTSPSPSPSPAVKPKSDDGVGPLSPESVSGSSSQDRWSTEKVK
AIKEACRAGNRKTVVELATSKDGLISDGIRKEAWPFLLGYGTVPHGKSVP
PTDIPEACPSWKTLPPHRDEDQVKLDVDRSFIYYPTNLSPRELRTRKTEL
LDLIVKVLRRHPMLCYFQGFHDICQVLLLVLGPTDAVAAVEHISLLRIRD
FMLPTMSPTSDHLQLLHPLLYSIDPKLFHHISRTQPFFALAATLTLYAHE
IQEYNKIARLFDVFLAMDPVFPLYLFAEIVLRRRDELFEIPDDEPEILHS
ILSKLPKPLDLDDLISRAVSLLEQQPPESLSTWHKVSSRSVLKTSRSLDQ
SPPSLSHAEKLFNQQWRELEWARKRKVMFKAIAKKGRITLLGLTLLVGTS
AIGLGFYLQKKGTPIDSISGSSVSPLLRRLLAGFGIGTGGCHFSVGNSCE
S

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig440 hypothetical protein BC1G_09780 [Botryotinia fuckeliana B05.10]6e-38


Manual Annotation:

Please find below the necessary files for GSTUMT00011228001 annotation :

link to GSTUMT00011228001 Artemis file
link to scaffold_80 sequence file
link to scaffold_80ESTs