Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011204001
Length(AA) : 408
Localization : scaffold_80
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : Tmelend3  [+]

Blast Results:

Nr Definition: endocytosis and cytoskeletal organization protein
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001548918.1| Score: 1141 E_value: 1e-123
KEGG Definition: hypothetical protein
Accession: ncr:NCU06347.1 Score: 1081 E_value: 1e-116
KOG Definition: Synaptic vesicle protein EHS-1 and related EH domain proteins
Classification: [Signal transduction mechanisms
Kog Number: KOG0998 Score: 304 E_value: 2e-28
PFAM Definition: No Hit Found
Swissprot: P39013|END3_YEAST
Gene Ontology:
GO:0030479 = Cellular component: actin cortical patch
GO:0030674 = Molecular function: protein binding
bridging
GO:0000147 = Biological process: actin cortical patch assembly
GO:0007015 = Biological process: actin filament organization
GO:0007121 = Biological process: bipolar cellular bud site selection
GO:0006897 = Biological process: endocytosis
GO:0030476 = Biological process: ascospore wall assembly

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.022NO0.046NO0.021NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0860.0660.91_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00046First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011204001
MANKPISQADVEKYWEIFSAHSKDGQRITGDQAFTMLKNSGLNDAQLAKI
WDLADVDRDGDLDFEEFCVAMRLIFDLVNGEYKQVPKTLPSFLIPESKAH
LVTASQALSDDPPRFERIDDDEDDTPGLKDGFDWYMSPVDKARYEGMYSA
NAGEHGQLRFNALDELYEGINVPDTDIRSAWNLVNPSASAAIGKDQALVF
LHILNNRHEGYRIPRSVPASLRATFQKNQISYDLDKNEDLVYKNKLGKGR
DMSTITGKKEAFGESYLTRLGVGGRGNYKHSGTDFSASKDQGWEEVRLKR
ELAELETKIAETEATAEKRRNRDKFGSSGSKAALVKRELEQMLDYKRRTL
RELEDGGGLAKSGANLKGVKEDLETVREQVNALEQHLKSREDTLAGLLRE
IEEEKARG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1674 hypothetical protein CIMG_05921 [Coccidioides immitis RS]6e-63
SY0AAD34YK03FM1 conserved hypothetical protein [Chaetomium globosum CBS 148.51]1e-28


Manual Annotation:

Please find below the necessary files for GSTUMT00011204001 annotation :

link to GSTUMT00011204001 Artemis file
link to scaffold_80 sequence file
link to scaffold_80ESTs