Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011193001
Length(AA) : 462
Localization : scaffold_8
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE55837.1| Score: 501 E_value: 2e-48
KEGG Definition: Fe2+/Zn2+ regulated transporter
Accession: aor:AO090005000823 Score: 501 E_value: 7e-49
KOG Definition: Protein involved in sister chromatid separation and/or segregation
Classification: [Cell cycle control
Kog Number: KOG4842 Score: 191 E_value: 3e-15
PFAM Definition: WLM, WLM domain. This is a predicted metallopeptidase domain called WLM (Wss1p-like metalloproteases). These are linked to the Ub-system by virtue of fusions with the UB-binding PUG (PUB), Ub-like, and Little Finger domains. More specifically, genetic evidence implicates the WLM family in de-SUMOylation..
Pfam Number: pfam08325 Score: 447 E_value: 7e-45
Swissprot: P38838|YHT4_YEAST
Gene Ontology:
GO:0016925 = Biological process: protein sumoylation
GO:0006974 = Biological process: response to DNA damage stimulus
GO:0010224 = Biological process: response to UV-B
GO:0010225 = Biological process: response to UV-C

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.132NO0.367NO0.117NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1120.1110.759_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00751First60=0.00705PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011193001
MTQDQIIGTYVHIPGKPREQHALYMLRWIASLVKPIMNKGGYKVGCLAEF
YPVQKSLLGLNVNNGEKVCIRLRQPYDDSVFLDIEECVYTMLHEITHNLH
GPHNDTFYAHLKTLEESYSTLRRGGYDGEGFYSEGKRLGAGIPKNPLMSE
ARRRALAMAEKRRDIYSGSGQMLGGGKDPLPSGLGIREKIAAATERRIRD
SQTCGAGSGARDRGAMEAEAERTIRAGTVTVGEEEEEEETKQEVVVLDED
PENEAAIMNAAIELIQEAEREEAEQKLLWEEQDGIVWIVDDEDGPIQVEL
PPAAATTAATTPSPPHPRIPAPIVITSSPPPPPPAEPQDLPPSYEQATTW
ACDLCTLINPSILPRCEACSFERPDSTDSATSPPPTPLSPIYQNPPLTQA
VIEGKERERERQKVRFLDMPLMIPEKRGEAATPAGWMCVRCGTGNGEGWW
GCGGCGVVRGEI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1259 No hit found
SY0AAB52YB17FM1 unnamed protein product [Aspergillus oryzae]2e-29


Manual Annotation:

Please find below the necessary files for GSTUMT00011193001 annotation :

link to GSTUMT00011193001 Artemis file
link to scaffold_8 sequence file
link to scaffold_8ESTs