Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011157001
Length(AA) : 715
Localization : scaffold_8
Number of EST contigs matching the gene: 1
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: oligosaccharyl transferase subunit (Stt3), putative
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP48863.1| Score: 2769 E_value: 0.0
KEGG Definition: AFR491Wp; K07151
Accession: ago:AGOS_AFR491W Score: 2317 E_value: 0.0
KOG Definition: Oligosaccharyltransferase
Classification: [
Kog Number: KOG2292 Score: 3033 E_value: 0.0
PFAM Definition: STT3, Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER..
Pfam Number: pfam02516 Score: 1638 E_value: 0.0
Swissprot: P39007|STT3_YEAST
Gene Ontology:
GO:0008250 = Cellular component: oligosaccharyl transferase complex
GO:0004579 = Molecular function: dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0042802 = Molecular function: identical protein binding
GO:0006487 = Biological process: protein amino acid N-linked glycosylation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.405NO0.984YES0.505YESN

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1040.0780.813_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=263.693First60=21.4203PredHel=12
Topology=(19-41,82-104,116-135,145-164,169-186,192-214,235-257,267-286,299-321,354-376,383-405,431-453)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011157001
MSSIEALLKDESTRNIRRLLKAVILLTIAGAAVSSRLFSVIRFESIIHEF
DPWFNFRASKYLVKNGFYNFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGA
IYHILRMLSMPVDIRNICVLLAPAFSGLTALATYLFTKEMKDESAGLLAA
AFIGIAPGYISRSVAGSYDNEAIAIFLLMFTFYLWIKALKDGSAFWGALC
ALFYFYMVAAWGGYVFITNMIPLHAFVLVLMGRYSSRLYVAYTSWFALGT
LGSMQVPFVGFLPIRSSEHMAALGVFGLLQLVGFVEFVRYQVPSRQFKTL
LKALIFIVFALSSAVLVLLTLSGVIAPWSGRFYSLWDTGYAKIHIPIIAS
VSEHQPTAWPAFFFDLEMLIWLFPAGIYMCFSTLQDQHVFVIIYGIMASY
FAGVMVRLMLTLTPVVCVSAAIALSNILDVYLSIKTPAAPAASSIAVIAA
FSIYLFVFVLHCTWVTSNAYSSPSVVLASRLPDGSQHIIDDYREAYYWLR
KNTPDDAKIMSWWDYGYQIGGMADRTTLVDNNTWNNTHIATVGKAMSSRE
EVAYPILRQHDVDYVLVIFGGLLGYSGDDINKFLWMIRIAEGVWPDEVKE
RDFFTPRGEYRVDDGATDTMKNSIMYKMSYYNYQSLFPAGQAQDRVRNAK
LPAVGPTLSILDEAFTSENWIVRIYKVKDLDNLGRDHVSAAAFDAGKKKS
KRTKVGKAQRKLRVV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1655 oligosaccharyl transferase stt3 subunit [Aspergillus terreus NIH2624]1e-98


Manual Annotation:

Please find below the necessary files for GSTUMT00011157001 annotation :

link to GSTUMT00011157001 Artemis file
link to scaffold_8 sequence file
link to scaffold_8ESTs