Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011022001
Length(AA) : 308
Localization : scaffold_79
Number of EST contigs matching the gene: 2
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_12760
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001586185.1| Score: 659 E_value: 4e-67
KEGG Definition: hypothetical protein
Accession: ang:An13g01190 Score: 654 E_value: 8e-67
KOG Definition: Sentrin-specific cysteine protease (Ulp1 family)
Classification: [General function prediction only].
Kog Number: KOG3246 Score: 399 E_value: 2e-39
PFAM Definition: Peptidase_C48, Ulp1 protease family, C-terminal catalytic domain. This domain contains the catalytic triad Cys-His-Asn..
Pfam Number: pfam02902 Score: 160 E_value: 7e-12
Swissprot: O13612|NEP2_SCHPO
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0005634 = Cellular component: nucleus
GO:0019784 = Molecular function: NEDD8-specific protease activity
GO:0000338 = Biological process: protein deneddylation
GO:0016925 = Biological process: protein sumoylation
GO:0006508 = Biological process: proteolysis

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.031NO0.145NO0.031NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.230.0450.796_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00059First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011022001
MPFRDAIREMSGFHRDEVTTSNPPTTSSAPTSSSSPPPPRSSGGGRGMMD
RMADAGGNLRLRRNEMKLRPEDPYLSYYDVCVTKEDIDCLKGDWLTDNNI
SFWEEYLEHEELKSPNNKVMLLRPSMVFLLKNTKDPLTLESALPDVKKAS
HIFLPINDCRNPSIPEGGTHWSLLVVGVSDRVAFHYDSLSPANCGEAREV
CKKLGVLLGFSLQFFDLEDTPQQDNGSDCGVHVCWAMKHLLVKRLLAVER
EKAVQMTLRGKRVDASGYRKEMFKICEGLRKKASRSTSPRTSKHDGKDSP
PRIGDDQT

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1071 hypothetical protein FG05026.1 [Gibberella zeae PH-1]5e-44
SY0AAD36YO14FM1 hypothetical protein FG05026.1 [Gibberella zeae PH-1]7e-48


Manual Annotation:

Please find below the necessary files for GSTUMT00011022001 annotation :

link to GSTUMT00011022001 Artemis file
link to scaffold_79 sequence file
link to scaffold_79ESTs