Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00011006001
Length(AA) : 757
Localization : scaffold_79
Number of EST contigs matching the gene: 3
Number of ESTs : 13
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_12811
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001586234.1| Score: 1611 E_value: 1e-177
KEGG Definition: DUF221 domain protein, putative
Accession: afm:AFUA_1G02130 Score: 1586 E_value: 1e-174
KOG Definition: Uncharacterized conserved protein
Classification: [General function prediction only].
Kog Number: KOG1134 Score: 909 E_value: 3e-98
PFAM Definition: DUF221, Domain of unknown function DUF221. This family consists of hypothetical transmembrane proteins none of which have any function, the aligned region is at 538 residues at maximum length..
Pfam Number: pfam02714 Score: 646 E_value: 9e-68
Swissprot: Q06538|YL241_YEAST

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.134NO0.601NO0.098NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1170.2710.698_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=201.055First60=21.3401PredHel=8
Topology=(32-54,112-134,174-193,495-517,547-569,590-612,632-654,661-683)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00011006001
MAIHTLHDGVTLLRSNNDTHIGLPTDTRRTDLPTQLVISTTLGLGAFLTF
CFLRPRWSSLYAARKKTLDSAASLPNLPKTFFGWIPVLWEITDEQVLSSA
GLDAYVFLSFFKMSIRFLSIAAVLALGLLMPIHLHFDHSVSKPRVSFSEW
ALRPAGRGMNVLGGKDKDEIKLDGPYLWAYVVFVYLFTALAVYLLLDQTK
KVLAVRQKYLGNKVTVTDRTVRLSGIPKVLRSEDALKEYIEGLRIGRVDS
VTICRNWAVLDRLMAQRRDLVRQLEEVYVVYSRHRKVGRDLEALPFIQPS
PPQPLQPGDEETQPLLNRGPRPSRGDDRPKMTIRVGLWGLKRKKVDAIDY
LRMKLKALDEEIIEARKKEYEPSSNAFVTMESVASAAIVIQAVLDPRANQ
MTATQAPAPPDIVWKNTYRSRSTLTGLAGLLNLSDIRRVLPGLADLLEGS
PIISSLIQNFLPTAVLTLFSILAPYFYDWLSNCQGQISQGDVELSLISKN
FFFTFFNVFFAFTTLGTAFTFNNLWEQLKGSLSDTTTIAYALARSLGNLA
SFYVNLIILQGIGMFPFRLLQFGSVALYPIMYAGAKTPRDFADLARPSTV
LPAGGLILGFGWVYFVIGYFTYKYQLLYSMDHPQHSTGQAWSMIFYRVIL
GLFIFQLAMAGFLAINHAFTRSLLIVPLLFVGIWLAWMFSRIYVPLNKFI
ALKVVREPEFVNGGAVPEDTVEEREKGERFINPNLVTPLEDPWVTGGRRQ
QQHQEYE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig75 No hit found
Contig4143 DUF221 domain protein, putative [Aspergillus clavatus NRRL 1]1e-163
SY0AAB51YJ15FM1 hypothetical protein SS1G_12811 [Sclerotinia sclerotiorum 1980]5e-34


Manual Annotation:

Please find below the necessary files for GSTUMT00011006001 annotation :

link to GSTUMT00011006001 Artemis file
link to scaffold_79 sequence file
link to scaffold_79ESTs