Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010945001
Length(AA) : 340
Localization : scaffold_78
Number of EST contigs matching the gene: 1
Number of ESTs : 13
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_10036
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001800319.1| Score: 1086 E_value: 1e-116
KEGG Definition: predicted protein
Accession: aor:AO090001000344 Score: 1053 E_value: 1e-113
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: Q0UDX8|CHS7_PHANO
Gene Ontology:
GO:0005789 = Cellular component: endoplasmic reticulum membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.276NO0.605NO0.197NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2540.4490.261S5167

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=152.321First60=9.00425PredHel=7
Topology=(57-74,87-109,114-136,149-171,186-208,215-237,247-269)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010945001
MSFGSFQSICETASIPLCSLVGPYGSSRVMRPGIEALCYSRSIETANTII
FQLANDFVHILALIMCSIMVLHVRSKFTAVGRKEITSFFYLFMLLTVISL
CLDSGVIPIGSAPYAYFTAVQAGLTSALCTCLLINGFIGFQVYEDGTALS
VWLLRLSTVAMFIVTGGVAICTFQSWIGLSPTKTMALFVVLYVVNALFLF
VYVACQVILVMATLEDRWPLGDIVFGVFFFVVGQVLLYAFSDKLCDKVSH
YLDGLFFSSICNLLGVMMVYKYWDSITKEDLEFSVGTKTNVWEVKELIPE
EDRRTTIFEHAGPTSDCATSTYNSSGNRVSQGYGGFSDRY

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4328 hypothetical protein SNOG_10036 [Phaeosphaeria nodorum SN15]1e-116


Manual Annotation:

Please find below the necessary files for GSTUMT00010945001 annotation :

link to GSTUMT00010945001 Artemis file
link to scaffold_78 sequence file
link to scaffold_78ESTs