Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010888001
Length(AA) : 395
Localization : scaffold_77
Number of EST contigs matching the gene: 3
Number of ESTs : 66
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_02195
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001595979.1| Score: 558 E_value: 3e-55
KEGG Definition: hypothetical protein
Accession: ang:An11g00750 Score: 558 E_value: 1e-55
KOG Definition: Predicted tRNA-splicing endonuclease subunit
Classification: [Translation
Kog Number: KOG4772 Score: 450 E_value: 2e-45
PFAM Definition: No Hit Found
Swissprot: O74908|SEN54_SCHPO
Gene Ontology:
GO:0031966 = Cellular component: mitochondrial membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.013NO0.023NO0.023NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0730.0450.957_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.02387First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010888001
MDEPEDGNIRNAQNNIQDADLSDETQDFRFLNLLNKTGTTALPRRGEKDF
EPDGTDLQDRVLNESRQAMHEALLGERKHSSKQHVSATWRPSQRMAEVHV
ARGPHFKTVGKADRRGVLWLLPEETIYLVERGNLECWWEEGVPMSLQGVY
ASALDGCGGLERYQVYTYLKRAGYILARAPTFFHDDDKVVEREERGEGII
GTIRPATTTPPGIFKQLFTSLFLTRTKPPPFGPVIAQGTYRTYDSIYSRL
SIIPTHHPPHTPTNMVAVASETPFRIAYKVWKPQPHFRKSDPPPADFLVA
VASARETSLPTLSQLSALFDSVPVDEKTGGKSQFRRLKDGHRKCLVSQSW
DTEVTTFIKFAHVGFWVGPIFYGKREGEGWREIGRWCRRERTRQR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3952 tRNA-splicing endonuclease subunit Sen54 (predicted) [Schizosaccharomyces pombe 972h-]2e-37
Contig5296 histone H2B.1 [Sclerotinia sclerotiorum 1980]3e-41
SY0AAC20YF16RM1 tRNA splicing endonuclease subunit (Sen54), putative [Aspergillus fumigatus A1163]1e-17


Manual Annotation:

Please find below the necessary files for GSTUMT00010888001 annotation :

link to GSTUMT00010888001 Artemis file
link to scaffold_77 sequence file
link to scaffold_77ESTs