Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010855001
Length(AA) : 811
Localization : scaffold_76
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_05548
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001555873.1| Score: 980 E_value: 1e-104
KEGG Definition: ankyrin repeat
Accession: aor:AO090001000528 Score: 946 E_value: 1e-100
KOG Definition: Ankyrin repeat and DHHC-type Zn-finger domain containing proteins
Classification: [General function prediction only].
Kog Number: KOG0509 Score: 316 E_value: 2e-29
PFAM Definition: No Hit Found
Swissprot: Q9ULJ7|ANR50_HUMAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.023NO0.055NO0.028NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3820.0320.702_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00369First60=0.00028PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010855001
MFQATIKNNSNSFNSNKNYVLNNCSVVGDRSQLLNWPSPLEPRLRHRDVR
ERRVGNVGEWLMETEEFVRWHGWSGRSEASNPVLFCYGDPGVGKTFISSL
VVDKLCDLAGGQNTAIACFYFDFGARKEQSATSMLGSLLKQMVSGMERIP
EDISTAFQEQQKVIGGRDPGLPDIVNMLQTITSSHRTFVCIDAMDECVAA
HRVKILESLKQILEKSPHTRIFATGRPHIQAEIEKRLTGRVISVSVGPRK
GDITAYLRVRLAEDETPDAMDESLEADILRRIPENISEMFLLVSLNIEAI
LQESTIYRRRERLNKMTDGLGLGDAYGATIERIKAQGGDKSRLGMAALMW
ISHAERPLRADELCHALGVDLGCTDFNVGNIPSISTLVSCCQGLITVDKE
GSTVRLIHFTLQEYLSAHPNIFNRPHSTIAEICLTYLNSQRVKAFSVDPP
LTTQETYFLEYCSVYWGVHAKREPSDCAISLALELLREEGYSQISTKFLL
AQVKHLPHWRIDDWSQFSGQHCASFFGITEVVTALIEVRCGDINRGGILG
YTPLAWAARNGHEEVVRILLGRGVVDPDKPGSDGSTPLSFAAENGHEGVV
KILLERGEVDPDKPGSDGSTPLSCAASSGNEGVVKLLLGRGEVNPDKPDD
YGWTPLLWAALSGHEGVVKLLLGRGEVNPDKPDNNGRTSLTWAASSGHEG
VVKLLLGRGEVNPDKPDNNGRTSLTWAAWSGHEGVVKILLGRGEVNPDKP
DNSGRTPLSFAAETGREEVVGILLGLEAVNPDTPAKWGQTPRSLATMCGH
KKVVALLRSRK

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA22YJ10FM1 Ankyrin repeat protein [Neosartorya fischeri NRRL 181]1e-13
SY0AAB25YB15FM1 Ankyrin repeat protein [Aspergillus fumigatus A1163]2e-47


Manual Annotation:

Please find below the necessary files for GSTUMT00010855001 annotation :

link to GSTUMT00010855001 Artemis file
link to scaffold_76 sequence file
link to scaffold_76ESTs