Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010734001
Length(AA) : 695
Localization : scaffold_74
Number of EST contigs matching the gene: 4
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: pps1 dual specificty phosphatase
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001274464.1| Score: 1603 E_value: 1e-176
KEGG Definition: dual specificity phosphatase
Accession: aor:AO090120000287 Score: 1603 E_value: 1e-176
KOG Definition: Dual specificity phosphatase
Classification: [Defense mechanisms].
Kog Number: KOG1716 Score: 256 E_value: 1e-22
PFAM Definition: DSPc, Dual specificity phosphatase, catalytic domain. Ser/Thr and Tyr protein phosphatases. The enzyme's tertiary fold is highly similar to that of tyrosine-specific phosphatases, except for a "recognition" region..
Pfam Number: pfam00782 Score: 229 E_value: 2e-19
Swissprot: P38148|PPS1_YEAST
Gene Ontology:
GO:0005515 = Molecular function: protein binding
GO:0008330 = Molecular function: protein tyrosine/threonine phosphatase activity
GO:0006470 = Biological process: protein amino acid dephosphorylation
GO:0007090 = Biological process: regulation of S phase of mitotic cell cycle

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.115NO0.268NO0.082NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2440.0760.695_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01065First60=0.00015PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010734001
MAAVAIQPPRDTPTPPPMPTTTPTPTLPLPGAASTTAPIPIPNKHMAVSG
PGAPNYGNPVTPPASPHSEESHSSEEGNRSMASLLSPAESYPLISESPPV
HTIDAAGVAASLNYSSRQSLPDIEQLFPWAHGLHPENSMQLAFFYARKKS
MRRAPTCYRGICIVKVGDMSCARLKGAITPEEVLPSNPATTGFLVVDPKE
GFNVRNFHIQVGKFACLSDIIIYGDNDVDPGEITRIAKRVSTAQLEYRAQ
YQRNSTREFPIYNTFVVQSPFSMFENYFPEIVTIDSAGNLTGKVIDFCHW
ERMEMCSMSRATEISKNVWLGSSADTAPEPEHEPPYGLLIEASDLAQLPS
IDSLRDLGEIMDRTDATQCIEFPGSGTMTPPRYTATEVDGIIDTCRFIQS
VANGGHQEAHDADGDLSMTPPREPRRILIHCTDGYTETSLLALAYLMYSE
GLPAHSAWIQLHTVKNRNFFAYEKDLHFLRFAEHRILEAAAEDKGYCLNY
AVLNPPGWIHRMDGSLPSRILSYMYLGNLQHANNHGLLAALGIKRVLSIG
EELSWTDKEKSKWGADNAMVVKDLQDNGCDPLEYQFRRCLDFIEEGRHAD
EPILVHCRVGVSRSATICIAEVMRALKLSLPRAYCYVRARRLNVIIQPHL
RFMYELLKFEEKISFKNRCTPKRELEWTHIAREIATMNRPYTRQN

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3755 hypothetical protein CHGG_08163 [Chaetomium globosum CBS 148.51]1e-10
Contig4499 hypothetical protein CIMG_09172 [Coccidioides immitis RS]4e-87
SY0AAA2YP16FM1 hypothetical protein An18g03040 [Aspergillus niger]2e-24
SY0AAA46YO17FM1 conserved hypothetical protein [Neosartorya fischeri NRRL 181]9e-28


Manual Annotation:

Please find below the necessary files for GSTUMT00010734001 annotation :

link to GSTUMT00010734001 Artemis file
link to scaffold_74 sequence file
link to scaffold_74ESTs