Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010683001
Length(AA) : 511
Localization : scaffold_72
Number of EST contigs matching the gene: 5
Number of ESTs : 15
  User annotation : No user annotation

Blast Results:

Nr Definition: CTP synthase
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001246057.1| Score: 1892 E_value: 0.0
KEGG Definition: hypothetical protein [EC:6.3.4.2]; K01937 CTP synthase
Accession: spo:SPAC10F6.03c Score: 1730 E_value: 0.0
KOG Definition: CTP synthase (UTP-ammonia lyase)
Classification: [Nucleotide transport and metabolism].
Kog Number: KOG2387 Score: 1980 E_value: 0.0
PFAM Definition: CTP_synth_N, CTP synthase N-terminus. This family consists of the N-terminal region of the CTP synthase protein (EC:6.3.4.2). This family is found in conjunction with pfam00117 located in the C-terminal region of the protein. CTP synthase catalyses the synthesis of CTP from UTP by amination of the pyrimidine ring at the 4-position..
Pfam Number: pfam06418 Score: 950 E_value: 1e-103
Swissprot: O42644|PYRG_SCHPO
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.031NO0.062NO0.028NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0610.0860.925_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03078First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010683001
MNVDAGTMAPTEHGEVFVLNDGGEVDLDLGNYERYLNITLTRENNITTGK
IYQHVIERERRGDYLGKTVQVVPHLTDAIQDWIERVARIPVDETSEEPDT
CIIELGGTVGDIESAPFIEAMRQLRRRVGKGNFLQIHVSLVPVVNGEQKT
KPTQQAIRDVRSAGLAPDLIACRCQEPLSKATVEKVAAFCDVAHEQVVAV
HDVNSTYHVPLLLEQQKLIHLLTSVLELEKLSIAPALIQKGIDIWNEWKT
LTLAQDRLFDKVDIALVGKYTDLHDSYLSVENPAKFHKAWHDVCTAGGIL
VPGGFGARGTEGMIAAAKWARTNKIPYLGICLGMQIAVIEYARHVVGLED
AHSVEISASSTNPVVIFMPEGSKTHLGGTMRLGIRPTIWQPNSEWSKLRR
LYGEKEAILERHRHRYEVNPEYIERLSGLNFVGKDDKGERMEIVELKDHP
YYVGVQFHPEYLSRVLSPSKPYLGFVAASAGVLDQMLEKLQKIQPTVAPA
AALVELNGTLE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig158 CTP synthase [Coccidioides immitis RS]8e-66
Contig2403 CTP synthase [Coccidioides immitis RS]0.0
SY0AAA22YK07RM1 No hit found
SY0AAB23YC01FM1 hypothetical protein SNOG_12915 [Phaeosphaeria nodorum SN15]4e-57
SY0AAB43YD03FM1 hypothetical protein SNOG_12915 [Phaeosphaeria nodorum SN15]5e-25


Manual Annotation:

Please find below the necessary files for GSTUMT00010683001 annotation :

link to GSTUMT00010683001 Artemis file
link to scaffold_72 sequence file
link to scaffold_72ESTs