Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010653001
Length(AA) : 73
Localization : scaffold_72
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: DNA-directed RNA polymerases N/8 kDa subunit superfamily
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001262893.1| Score: 341 E_value: 7e-31
KEGG Definition: DNA-directed RNA polymerases N/8 kDa subunit superfamily [EC:2.7.7.6]; K03007 DNA-directed RNA Polymerase II subunit L
Accession: afm:AFUA_7G02620 Score: 319 E_value: 1e-28
KOG Definition: DNA-directed RNA polymerase
Classification: [
Kog Number: KOG3497 Score: 310 E_value: 5e-30
PFAM Definition: RNA_pol_N, RNA polymerases N / 8 kDa subunit..
Pfam Number: pfam01194 Score: 252 E_value: 3e-23
Swissprot: P22139|RPAB5_YEAST
Gene Ontology:
GO:0005736 = Cellular component: DNA-directed RNA polymerase I complex
GO:0005665 = Cellular component: DNA-directed RNA polymerase II
core complex
GO:0005666 = Cellular component: DNA-directed RNA polymerase III complex
GO:0003899 = Molecular function: DNA-directed RNA polymerase activity
GO:0005515 = Molecular function: protein binding
GO:0006366 = Biological process: transcription from RNA polymerase II promoter

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.301NO0.530NO0.228NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1110.1840.714_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00012First60=0.00012PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010653001
MIIPIRCFSCGKVVGDLWERYLKLLEDGVAEGDAMDQLGCKRYCCRRMLM
THVDLIEKLLRYNPQERTRIGRG

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB33YG09FM1 DNA-directed RNA polymerases N/8 kDa subunit superfamily [Neosartorya fischeri NRRL 181]8e-30


Manual Annotation:

Please find below the necessary files for GSTUMT00010653001 annotation :

link to GSTUMT00010653001 Artemis file
link to scaffold_72 sequence file
link to scaffold_72ESTs