Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010538001
Length(AA) : 1037
Localization : scaffold_70
Number of EST contigs matching the gene: 3
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_14173
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001547438.1| Score: 2717 E_value: 0.0
KEGG Definition: hypothetical protein [EC:3.5.4.6]; K01490 AMP deaminase
Accession: mgr:MGG_05630 Score: 2500 E_value: 0.0
KOG Definition: Adenosine monophosphate deaminase
Classification: [Nucleotide transport and metabolism].
Kog Number: KOG1096 Score: 2425 E_value: 0.0
PFAM Definition: A_deaminase, Adenosine/AMP deaminase..
Pfam Number: pfam00962 Score: 672 E_value: 1e-70
Swissprot: P50998|AMPD_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0003876 = Molecular function: AMP deaminase activity
GO:0006807 = Biological process: nitrogen compound metabolic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.019NO0.045NO0.021NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1030.0460.919_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.08699First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010538001
MPTPENAPPRDPSSEGSDQCRLNLRVTGASGVGWDDSDRLLDSPGDLRPP
SPEDDHADQDSLGGSDEERKSAFYDYKQEKALKQTDAKMFYQQQQQANSG
WNSPIMRASTGNWAGPGGSGGIGNPSRAGSVRSFTSSHQLPLHHHPHHQY
LGSAAGGSTLGIAGSRSLANATPAPLGMVSLEQPKEHEGIQAPDMARFDP
HGVVASAARQSGDSISPHGEILPQSQGGYIDRDPALSAELSTIYTNVQKI
LDIRHKYLRVSLQGHADNPKDDPSWKIYPPPPPPVWKEEANATAQKEARK
PGQNIGGDFIFEECEIPGEDEMEFRKDGHGVFQVYENKKALDAGMPVVAI
PTLREYYIDLDKVLDISSDGPSKSFAFRRLQYLEGKWNLYTLLNEHQEMA
DSKRVPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKHKIRRCPDEKVLFR
DGKHLTLTEVFASINLTAYDLSIDTLDMHAHTDSFHRFDKFNLKYNPVGE
SRLRTIFLKTDNDIKGRYLAEITKEVFQDLEASKYQMAEYRISIYGRAED
EWDKLAAWVVDNKLFSHNARWLIQVPRLYNVYKSTGLINSFDEVVRNIFK
PLFEVTKDPSSHPKLHVFLQRVVGFDSVDDESKAERRTFRKFPSPPEWTV
KSNPPYSYWIYYLFANTASLNVWRKQRGFNTFVVRPHCGEAGDTDHLAAA
VLCCHSISHGILLRKVPLLQYIFYLDQIGIAMSPLSNNALFLAYDKNPFL
SYFKRGLNVSLSTDDPLQFAFTKEPLIEEYSVAAQIYKLSAVDMCELAKN
SVLQSGFEGAIKARWLGNDYHVPGPEGNNMDKSNVPNIRMAFRHQTLHEE
LRMLGRYTSAQAMANAAGPQGAGLAGRLTLPGSPFPGFRPPSPTTSMQTN
PTSVQEPPSPQGDLPLPIQFPTSPGSSKLLASVHIHDLQGQTASPNPPGT
ESRDGYPSFPVPARANTTGTAALLRHHTSGSSGSPSGYGDYHISGSEPRV
WPGVISRRQASISEKDCTNKGVENEAKGSNNGSVAGG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4445 No hit found
Contig6520 AMP deaminase [Aspergillus terreus NIH2624]1e-108
SY0AAA3YB06FM1 hypothetical protein CHGG_05913 [Chaetomium globosum CBS 148.51]1e-37


Manual Annotation:

Please find below the necessary files for GSTUMT00010538001 annotation :

link to GSTUMT00010538001 Artemis file
link to scaffold_70 sequence file
link to scaffold_70ESTs