Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010528001
Length(AA) : 411
Localization : scaffold_70
Number of EST contigs matching the gene: 14
Number of ESTs : 490
  User annotation : TmelCys3  [+]

Blast Results:

Nr Definition: cystathionine gamma-lyase
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001261981.1| Score: 1513 E_value: 1e-166
KEGG Definition: cystathionine gamma-lyase [EC:4.4.1.1]; K01758 cystathionine gamma-lyase
Accession: afm:AFUA_8G04340 Score: 1510 E_value: 1e-166
KOG Definition: Cystathionine beta-lyases/cystathionine gamma-synthases
Classification: [Amino acid transport and metabolism].
Kog Number: KOG0053 Score: 1092 E_value: 1e-120
PFAM Definition: Cys_Met_Meta_PP, Cys/Met metabolism PLP-dependent enzyme. This family includes enzymes involved in cysteine and methionine metabolism. The following are members: Cystathionine gamma-lyase, Cystathionine gamma-synthase, Cystathionine beta-lyase, Methionine gamma-lyase, OAH/OAS sulfhydrylase, O-succinylhomoserine sulfhydrylase All of these members participate is slightly different reactions. All these enzymes use PLP (pyridoxal-5'-phosphate) as a cofactor..
Pfam Number: pfam01053 Score: 1252 E_value: 1e-138
Swissprot: P31373|CYS3_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0004123 = Molecular function: cystathionine gamma-lyase activity
GO:0042802 = Molecular function: identical protein binding
GO:0042493 = Biological process: response to drug
GO:0019346 = Biological process: transsulfuration

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.161NO0.161NO0.095NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1510.0350.886_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03138First60=0.00603PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010528001
MTIATLPIEDAPRFQKDNRGFATRAVQTGSPHDPITGAVITPISLSTTFA
QTSVGNPVGLYEYSRSSNPNRDNFEHAVAALENANYALAFSSGSATTATI
LQSLATGSHVISISDVYGGTHRYFTKVAAAHGIRVTFTGAIEVDARAMIE
KNTKLIWIETPSNPTLSLVDIQSVADVAHEHGIMVVVDNTFLSPYVQNPL
DHGADIVIHSVTKYINGHSDVLMGVAAYNSPELNDTLTFLQNAIGAVPSP
FDCWLAHRGLKTLHLRAKAANENASAIAQFLESSPHVISVNYPGLNSHPQ
RKVALKQHRKAMGGGMISFRIRGGIRAAERFCKETRIFTLAESLGGVESL
CEVPASMTHAGIPIAAREKSGVFDDLIRLSVGIEDVDDLVDDISGAIARV
IDSLMLEEATA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2202 cystathionine gamma-lyase [Neosartorya fischeri NRRL 181]1e-165
Contig3946 No hit found
Contig7452 hypothetical protein AN1446.2 [Aspergillus nidulans FGSC A4]1e-130
SY0AAA43YA17FM1 hypothetical protein AN1446.2 [Aspergillus nidulans FGSC A4]2e-68
SY0AAC19YL23FM1 No hit found
SY0AAC21YO24FM1 cystathionine gamma-lyase [Neosartorya fischeri NRRL 181]6e-53
SY0AAC34YL08FM1 cystathionine gamma-lyase [Neosartorya fischeri NRRL 181]5e-67
SY0AAC40YH13FM1 No hit found
SY0AAC42YN16FM1 cystathionine gamma-lyase [Neosartorya fischeri NRRL 181]3e-33
SY0AAD21YE14FM1 hypothetical protein An16g08720 [Aspergillus niger]1e-29
SY0AAD36YO24FM1 hypothetical protein Bm1_17870 [Brugia malayi]2e-19
SY0AAD43YI05FM1 cystathionine gamma-lyase [Neosartorya fischeri NRRL 181]6e-65
SY0AAD53YM20FM1 hypothetical protein An16g08720 [Aspergillus niger]5e-26
SY0AAD8YE03FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00010528001 annotation :

link to GSTUMT00010528001 Artemis file
link to scaffold_70 sequence file
link to scaffold_70ESTs