Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010517001
Length(AA) : 380
Localization : scaffold_70
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An06g01210
Specie: [Aspergillus niger]
Accession: ref|XP_001390947.1| Score: 460 E_value: 7e-44
KEGG Definition: hypothetical protein
Accession: ang:An06g01210 Score: 460 E_value: 3e-44
KOG Definition: Protein involved in rRNA processing
Classification: [RNA processing and modification].
Kog Number: KOG3117 Score: 388 E_value: 3e-38
PFAM Definition: Sas10_Utp3, Sas10/Utp3/C1D family. This family contains Utp3 and LCP5 which are components of the U3 ribonucleoprotein complex. It also includes the human C1D protein and Saccharomyces cerevisiae YHR081W (rrp47), an exosome-associated protein required for the 3' processing of stable RNAs, and Sas10 which hash been identified as a regulator of chromatin silencing..
Pfam Number: pfam04000 Score: 146 E_value: 4e-10
Swissprot: Q09713|YA36_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.278NO0.550NO0.216NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0320.8080.333S323

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.07718First60=0.0649PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010517001
MSPPPDLLETLTTLTASLTTTSTSIQSAEFPTLTSPENGISLLGLKNELL
LSYVHNIVFLVLVRLRSGTLSNGIGADAVKELVKIRVLLERGVKPLEGKL
KYQIDKVIAAASSSMPAGTAPATTKEEIEVRNGKGSGEDSSDEDEDVTAN
NCDYYPLQEKPRSDVAAASAPVSALTRKELAFRPNPAALVKPSAPALSSS
TTNLSDGIYRPPRISATAMPEPNRSAEKGKPPRRKSHMLDEFVMEELSTA
PTVESSVGSTIIDSGRVVKTARDRREERERQEYEENNFVRLPKMGKKEAR
ELKRRGGREVNGMGGEDWSGFTGDIERLTKEVDRAGKSARLLEKSRKRKG
DGDNEEGGSSRVVGDSFERKKERLSKRRKT

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3787 conserved hypothetical protein [Aspergillus terreus NIH2624]4e-12
Contig4529 hypothetical protein SS1G_14217 [Sclerotinia sclerotiorum 1980]8e-29


Manual Annotation:

Please find below the necessary files for GSTUMT00010517001 annotation :

link to GSTUMT00010517001 Artemis file
link to scaffold_70 sequence file
link to scaffold_70ESTs