Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010508001
Length(AA) : 518
Localization : scaffold_7
Number of EST contigs matching the gene: 7
Number of ESTs : 141
  User annotation : No user annotation

Blast Results:

Nr Definition: acyl-CoA dehydrogenase, putative
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001271742.1| Score: 2105 E_value: 0.0
KEGG Definition: acyl-CoA dehydrogenase, putative [EC:1.3.99.-]; K00257
Accession: afm:AFUA_4G08490 Score: 2088 E_value: 0.0
KOG Definition: Medium-chain acyl-CoA dehydrogenase
Classification: [Lipid transport and metabolism].
Kog Number: KOG0140 Score: 498 E_value: 1e-50
PFAM Definition: Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, C-terminal domain. C-terminal domain of Acyl-CoA dehydrogenase is an all-alpha, four helical up-and-down bundle..
Pfam Number: pfam00441 Score: 345 E_value: 5e-33
Swissprot: Q9H845|ACAD9_HUMAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.022NO0.079NO0.025NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0860.0660.902_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.48927First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010508001
MSKTFKATEVAEHKKPDSLWIIVEDDVYDVTKFQNDHPGGKKILQRVGGK
DATAQFWKYHNEGILKKYKAQLQIGSLEGKAKVEPKEEQALDTYGDLIPF
GDPAWYQGYHSPYYNASHAALRDEVRAWVEEKIEPHLNDWEKQKFVPVEI
YKEMGTRGYLPGLLGVKYPKEYTPYSVASVPPEKWDHFHEFILTDELSRT
GSGGFVWNMIGGYSIGLPLVLKFGRKELKDRILPGMVTGEKRICLCITEP
GAGSDVANLNCEANKTSDGRHYIVNGEKKWITNGIWSDYFTVAVRTGGPG
MGGVSVLLIERGPGVSTREMDCQGVHGSGTAYITFEDVKVPVENLIGREN
AGFKVIMTNFNHERLGIVIQCTRFSRVLYEESMKYANRRRTFGKKLIEHP
VIRMKLAHMARQIEATHNWLENIVYQGSCMGDTEAMLKLGGAIAGLKAQS
TTTFEFCAREATQIFGGIGYTKGGVGAKVERLYRDVRGYAIPGGSEEIML
DLSIRQSLKVHQALGMKL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3612 acyl-CoA dehydrogenase, putative [Aspergillus clavatus NRRL 1]0.0
Contig3932 hypothetical protein SS1G_11976 [Sclerotinia sclerotiorum 1980]3e-65
Contig5954 acyl-CoA dehydrogenase [Botryotinia fuckeliana B05.10]1e-75
Contig6431 acyl-CoA dehydrogenase [Botryotinia fuckeliana B05.10]6e-67
Contig7113 acyl-CoA dehydrogenase [Botryotinia fuckeliana B05.10]5e-62
SY0AAA22YE20FM1 hypothetical protein FG10790.1 [Gibberella zeae PH-1]4e-80
SY0AAD52YO23FM1 hypothetical protein NCU02287 [Neurospora crassa OR74A]3e-67


Manual Annotation:

Please find below the necessary files for GSTUMT00010508001 annotation :

link to GSTUMT00010508001 Artemis file
link to scaffold_7 sequence file
link to scaffold_7ESTs