Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010478001
Length(AA) : 794
Localization : scaffold_7
Number of EST contigs matching the gene: 3
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001272626.1| Score: 461 E_value: 1e-43
KEGG Definition: conserved hypothetical protein
Accession: afm:AFUA_6G07110 Score: 456 E_value: 2e-43
KOG Definition: WASP-interacting protein VRP1/WIP
Classification: [
Kog Number: KOG4462 Score: 131 E_value: 6e-08
PFAM Definition: Drf_FH1, Formin Homology Region 1. This region is found in some of the Diaphanous related formins (Drfs). It consists of low complexity repeats of around 12 residues..
Pfam Number: pfam06346 Score: 119 E_value: 1e-06
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.054NO0.414NO0.067NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0870.2570.854_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01794First60=0.00116PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010478001
MPVLEMRPSISDEEMGQKLPIHDQLSPLEVMLAVYTPILECLVKHLPTPS
KLKLAQTSTYLRHLLLRYPPFYSHFDFRLSAYEAPGFDTYHLGTIYNLDK
FISSLSLETRITSLTLDWTAVTGLFLFGPLMTRCAGTLEHLSVRGCRKVS
IKHHIVPYLVYQDIVEPHSVSTPIPPKRALKSLYVYKARGVRRKPFLIDR
KPADGDEPSRYLTTLAEKLGIWTDLGLCPTPKLRCPRRKEILRRGKEKYC
VPFDKRWRVQDPEASQGNPTLALLSPHELQQRRKWEETEGLFTCDNCEAR
ILDRCEACVYQMTCSNCKKAICHSCAYDRPAGPIAPAETVPNGAPGVLPP
LMAPEGPWPNPTTAGISAMATMAPQIGVNANGNGNGNGPQFQVVLATLIQ
LDLPVPGAPTNIPLAPTFYQPTVPSATETNPVVHFLQPCCQTVTPNSADI
LCGSCMTSISWAHCDCCGKQICIKHELSGSRRCRGGCEKVFCSSSDAPSA
PIGCGDPAEGKAGIKSCLTCGNDVCADCRLDSLHAPPSSDDGTESEVEEA
ALEKCACDCKVCQDNFYCTDCWPKKTTKCETRHTKFDHKVRGIINHRSID
PAKDINLYLVTFVDVPDKKWVTRARIEEDYGSDTRILSAYSPTDPPPPPP
TPELTDPTTEPEPPQEDEILVGEKEWIMEKILGKAIHPCPPLPTATSSSP
APASPAPLPPRPSAAPPPPPDQQTEIYQIKWLGRSTSEATWEPKSGFAVN
SREHVLMESYDIEGPISEHRGERDFGVIGEHCDITAMAGGGPFI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1689 conserved hypothetical protein [Ajellomyces capsulatus NAm1]3e-10
Contig5946 hypothetical protein SNOG_06275 [Phaeosphaeria nodorum SN15]1e-17
SY0AAC20YH08FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00010478001 annotation :

link to GSTUMT00010478001 Artemis file
link to scaffold_7 sequence file
link to scaffold_7ESTs