Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010415001
Length(AA) : 309
Localization : scaffold_7
Number of EST contigs matching the gene: 1
Number of ESTs : 4
  User annotation : Tmelcdc2  [+]

Blast Results:

Nr Definition: cdk1
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001257919.1| Score: 1321 E_value: 1e-144
KEGG Definition: cell division control protein 2 kinase, putative [EC:2.7.11.22]; K04563 cyclin-dependent kinase
Accession: afm:AFUA_6G07980 Score: 1303 E_value: 1e-142
KOG Definition: Protein kinase PCTAIRE and related kinases
Classification: [General function prediction only].
Kog Number: KOG0594 Score: 1133 E_value: 1e-124
PFAM Definition: Pkinase, Protein kinase domain..
Pfam Number: pfam00069 Score: 692 E_value: 1e-73
Swissprot: P54119|CDC2_AJECA
Gene Ontology:
GO:0004693 = Molecular function: cyclin-dependent protein kinase activity
GO:0008353 = Molecular function: RNA polymerase subunit kinase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.015NO0.027NO0.017NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0710.0690.938_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00883First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010415001
MENYQKIEKIGEGTYGVVYKAKDLKNGNRIVALKKIRLEAEDEGVPSTAI
REISLLKEMSDPNIVKLLNIVHADGHKLYLVFEFLDLDLKKYMEAIPSGM
GLGTDMIKRFMSQLVEGVRYCHAHRILHRDLKPQNLLIDKEGNLKLADFG
LARAFGVPLRTYTHEVVTLWYRSPEILLGGKQYSTGVDMWSVGCIFAEMC
TRKALFPGDSEIDEIFKIFQLLGTPDEETWPGVTSFPDFKPSFPQWAKVD
TEKMVPGLEAAGVDLLEAMLVYDPAGRISAKQACHHDYFNAEDGTNWNNG
RPNSRFQGR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1667 cdk1 [Neosartorya fischeri NRRL 181]2e-83


Manual Annotation:

Please find below the necessary files for GSTUMT00010415001 annotation :

link to GSTUMT00010415001 Artemis file
link to scaffold_7 sequence file
link to scaffold_7ESTs