Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010403001
Length(AA) : 615
Localization : scaffold_7
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : TmelgatA  [+]

Blast Results:

Nr Definition: hypothetical protein CIMG_03277
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001243836.1| Score: 1141 E_value: 1e-122
KEGG Definition: hypothetical protein
Accession: ang:An01g13000 Score: 1108 E_value: 1e-119
KOG Definition: Amidases
Classification: [Translation
Kog Number: KOG1211 Score: 525 E_value: 8e-54
PFAM Definition: Amidase, Amidase..
Pfam Number: pfam01425 Score: 717 E_value: 4e-76
Swissprot: Q1IUE4|GATA_ACIBL
Gene Ontology:
GO:0050567 = Molecular function: glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity
GO:0006412 = Biological process: translation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.027NO0.068NO0.026NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1250.0580.875_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.9771First60=0.00932PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010403001
MAEVINSKGVGYPEPIAAPSAPYVNPRDSNPTLTGLPLRVLGEVVSSFGP
LQSILWSNANFDSLRQLEESGVLDRFLPRFDPTVIPSKLPAPAPSLPSES
SMTSSVFNSSASYTAQFASGKLTPVTVINERLLPLFTSPKSPHSVCVITP
VTPSAGASASTSRYAASTAHTSGIDGVPILVKDEFSLAGTPRTMGLTKAE
MTRRAYSASEEGQTSWCVQKLIDAGALVVGKANMHEIGFDTTNNNPNWGT
PRNPYNKGYYPGGSSGGCAYAVGAGLVPIAVGADGGGSIRIPAAYCGVYG
LKPTHGRVSHRPTLSIAASNGVVGPIAATISDLELAYRIMATPDPQDPVS
INFSQPKKPPVEAHTGKRIIGIYKPWFEDCDQEVKDVTNTAVKWLETEAG
YEVVDIEIPYLKEGRTAHAITIMTEIGQGFCKGEASGLTPANKLLVGVSN
KTPARDFNIAQRVRAMLMSHLSSLFATHTDSLVILSPVTPHIGVKIGSES
HVAKGGSGISDANTSLKSMQYVFLANFTGCPSISVPVGYSLTEGVPIGLM
GMAAWGGEEVLLGLGECTERYFEGVVGRRKGGGEEGERGGVYVDVLASEG
QLDGGGGDGPASPGS

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAC10YO16FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00010403001 annotation :

link to GSTUMT00010403001 Artemis file
link to scaffold_7 sequence file
link to scaffold_7ESTs