Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010371001
Length(AA) : 1006
Localization : scaffold_7
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An01g10060
Specie: [Aspergillus niger]
Accession: ref|XP_001389425.1| Score: 986 E_value: 1e-104
KEGG Definition: hypothetical protein
Accession: ang:An01g10060 Score: 986 E_value: 1e-104
KOG Definition: No Hit Found
PFAM Definition: Fungal_trans, Fungal specific transcription factor domain..
Pfam Number: pfam04082 Score: 160 E_value: 2e-11
Swissprot: Q9UTN0|YII3_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0005819 = Cellular component: spindle

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.013NO0.027NO0.018NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1160.0480.911_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.18679First60=0.00315PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010371001
MKRQRTREDSEGADGETSEGYSTVGVTAGTNGPEFTSFARGKPEDLEARM
NRLAEIVDRWYKDAYGQRIIPPVARQQAVDAVGVNNSDAKSSFEGTLGQI
PTRERLVPQEQGVSDNMRKLTYSISGISCAPAHSIPCSSVSSSHSPRSRD
TITTPSSSADGYSQQVCTLEGKNGATHPPKQMARGQLAMKLLDEEIEAAR
GKGTCDDIGDLGLGHLSIQGRGRSRYVGSSFWASISHEIAELNDVLRANE
PPDTRCSAGPPPEEMIGLFQKPRNSTTSETASRSTASGTAEPLRPSSTAS
APNFCGLSQFDKSSLLQFEPRERGGNPFEIIPLILRDLPDKPMCDIMYKA
FLNGVHPIMPLIHVPTFAKEYNAFWAWFPNNIRSIPDPTLTENHGFFPLL
LSVLYAGSMSLPAKVIEKILTGQSKIEVTKSLYSGSMHALSASSFPRTPT
VSSLIAFLITQTCLIREEEPLTSCSFLGMAMRVAQSMGLHRDGSLFGLNE
IECEVRRRVWWHILYLDVQGAIATGLPPLGGSGEELFDTKMVSELKDEYI
GLSPEERKKVTEAATAAAEPQTSVNHMAHTCKALLDEHPNSPAMILAAGR
YDMTIVLRKVVIQLLSTRPPQKADLMEMGGAIFELKLRLEDRIARIPARG
IPEMGFTPPHDPEFHELMGHNESFFDTEKAIVFNGWARIMLSMFSDRTFG
VFYQSFLKRSKSRLWDHARHCALHFCVSFLQKFVHVSKNPLFQPYQWFCP
GTFQPLHATMILLIDLHERPQSPEAPQSRMFVDEIFALFGEDGNSLVGAP
GGNRPLLEGGSLAWKMLARLRKKAYEKAGIKIDKPAERREEEGMATPTAP
AKARSIAKCNMPPNPDTLTTPAAKDAGGKPGPDVLPPLDIPTGGYEEMLF
IADNVATGTGRYKDTTEAAMKIWEAMAAAGIAVDDDAPMDPGMPTPPLME
PPLKELPMGVPTGDVAGTGADDVMDFDWEEWDAMFGRFTAIEGMVLSDMP
VQRGPE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1678 hypothetical protein CIMG_02974 [Coccidioides immitis RS]6e-33
SY0AAB8YC07FM1 C6 transcription factor, putative [Aspergillus clavatus NRRL 1]1e-08


Manual Annotation:

Please find below the necessary files for GSTUMT00010371001 annotation :

link to GSTUMT00010371001 Artemis file
link to scaffold_7 sequence file
link to scaffold_7ESTs