Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010343001
Length(AA) : 521
Localization : scaffold_7
Number of EST contigs matching the gene: 1
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_06870
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001797231.1| Score: 853 E_value: 3e-89
KEGG Definition: ATPase
Accession: sde:Sde_0331 Score: 515 E_value: 2e-50
KOG Definition: Uncharacterized conserved protein
Classification: [
Kog Number: KOG3833 Score: 294 E_value: 4e-27
PFAM Definition: UPF0027, Uncharacterized protein family UPF0027..
Pfam Number: pfam01139 Score: 549 E_value: 1e-56
Swissprot: Q9YB37|Y1758_AERPE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.133NO0.338NO0.106NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6850.0190.411M435

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.17052First60=0.00038PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010343001
MPHTRILVKLNSNQSISAPCLLPQTLNPRAQLLSYAKSKFRTKATRVFLP
GGEELLTPQAVQEVLDLCHERRTVGPTFLLSAGEPYVGALAPPSPARAEI
RACEVHVIAEDSYIDPQAITQLEAAAKLPGMVRAVGLPDLHPGGKFPVGA
AFVSERFIYPSLVGSDIGCGMTLFLTGLTRKKLEDQTGMRRVAESLRGLE
TAWRSPQERTAWLGNCAAGDEWDRSVGTIGGGNHFAEFQIVEEVEEGHGL
CSGIVVLLIHSGSRRFGKHILETFTKDDKSVSLAYGDPKTAEYLKLHTQA
CNWASKSRDLIALRIFECIEGSRWALPETIDLDTAAHLNARLQGRRVLDI
LHNSVTATLWPPHAEAQYQKPMFIHRKGAAPAPPGTPFLPLPGSRGTPTL
LVKPLFSELNQNGFKNGLSLAHGAGRMLSRNEARGLSRKYNNDVKVLTEM
KPMEMRGGGKGRVVTSGYVICDEKELVWEEAVEAYKNVEIVAQDLEKCGA
AKVMGKCVPKVTYKVRNDSLS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1873 hypothetical protein SNOG_06870 [Phaeosphaeria nodorum SN15]9e-82


Manual Annotation:

Please find below the necessary files for GSTUMT00010343001 annotation :

link to GSTUMT00010343001 Artemis file
link to scaffold_7 sequence file
link to scaffold_7ESTs