Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010262001
Length(AA) : 770
Localization : scaffold_68
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001248653.1| Score: 2147 E_value: 0.0
KEGG Definition: peptide exporter, ABC superfamily; K02021 putative ABC transport system ATP-binding protein
Accession: aor:AO090003001232 Score: 2134 E_value: 0.0
KOG Definition: Peptide exporter
Classification: [
Kog Number: KOG0058 Score: 1826 E_value: 0.0
PFAM Definition: ABC_membrane, ABC transporter transmembrane region. This family represents a unit of six transmembrane helices. Many members of the ABC transporter family (pfam00005) have two such regions..
Pfam Number: pfam00664 Score: 419 E_value: 2e-41
Swissprot: Q9Y7M7|YNT9_SCHPO
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion
GO:0005524 = Molecular function: ATP binding

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.225NO0.405NO0.231NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8190.0450.168M263

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=115.341First60=0.00156PredHel=5
Topology=(144-166,188-210,282-304,365-387,394-416)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010262001
MRSSPSLSSSLRSATCPRVTGFTPPPPRLICHSAKAQTIVTPTTRFPPFN
CVSRSAVWSRGRCLSTSPILREVRSGNTTEKPLTEPQKSTSVELEFEAFG
RSEKATKAAQVNLSARLHKDGNPSAVKPVLGEIVRLLKIARPEAKWLSVA
FVFLLMSSAISMSIPFSIGKILDMATRTDVGTLLGLQLPQFYMVLGGVLC
LGAACNYGRIVLLRIIGERIVARLRSQLFHRTYVQNAEFFDANRIGDLIS
RLSSDTVVVGKSITQNVSDGLRALVTGTAGLGLMAYVSLKLTAVLSIMFP
PVAIGAFFYGRSIRNLSRKIQRNLGTLTKIAEERLGNVRTSQAFTGEILE
VSRYNRQVKKIFALGKKESLITATFFSSTGLIGNMTILAILYIGGQQVKS
GAISIGELSSFLMYTAYAGSSLFGLSSFYSELMKGVGAASRLFELQDRKP
SISPTVGIPVTSARGTIKFENVCFSYPTRPAVAIFNDLTFSIPPGTNVAI
VGPSGGGKSTIGGLLLRFYDPTSGNIAINDVPVSTMNLKSLRRRIGLVSQ
EPVLFSGTIAENISYGKPTATRSEIITAARKANCTFISDFPDGLETYVGA
RGAMLSGGQKQRIAIARALVKNPDILVLDEATSALDAESETAVNEALNGL
MKSDCTTISIAHRLSTIKRSDRIIVLGIDGRVAETGSFRELSARDGPFSR
LMEWQLHGGEVPAPLLRHWGTLGEREVDEEVGDDVEGGVEGIEEEEEEEG
SRVERGKMVNVALKAPGDNR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2625 ABC multidrug transporter Mdr2 [Aspergillus clavatus NRRL 1]1e-63
SY0AAB3YD13FM1 hypothetical protein BC1G_10363 [Botryotinia fuckeliana B05.10]2e-66


Manual Annotation:

Please find below the necessary files for GSTUMT00010262001 annotation :

link to GSTUMT00010262001 Artemis file
link to scaffold_68 sequence file
link to scaffold_68ESTs